KEGG   Tribolium castaneum (red flour beetle): 656930
Entry
656930            CDS       T01046                                 
Name
(RefSeq) ubiquitin-60S ribosomal protein L40
  KO
K02927  ubiquitin-large subunit ribosomal protein L40e
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca03010  Ribosome
tca04120  Ubiquitin mediated proteolysis
tca04137  Mitophagy - animal
Brite
KEGG Orthology (KO) [BR:tca00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    656930
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    656930
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    656930
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:tca03011]
    656930
   04121 Ubiquitin system [BR:tca04121]
    656930
Ribosome [BR:tca03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    656930
  Archaea
    656930
Ubiquitin system [BR:tca04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitins
   656930
SSDB
Motif
Pfam: ubiquitin Ribosomal_L40e Rad60-SLD Ubiquitin_2 TBK1_ULD Rad60-SLD_2 DUF2604 Ubiquitin_5 Dsc3_N
Other DBs
NCBI-GeneID: 656930
NCBI-ProteinID: XP_968519
UniProt: D2A1G0
Position
LG4:complement(488734..489591)
AA seq 129 aa
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGIIEPSLRLLAQKYNCDKMICRKCYARLHPRATNCRKTKCGHTNN
LRPKKKLKG
NT seq 390 nt   +upstreamnt  +downstreamnt
atgcaaattttcgtgaaaactctgaccggcaagaccatcactcttgaggtcgagccttca
gacaccatcgaaaatgtcaaagcgaaaattcaggacaaggaaggcattccccccgatcaa
cagcgtttgatttttgcgggtaaacagctggaggatggacgcactttgtccgattacaac
atccagaaggaatccacccttcatttagttttgcgtctgcgaggtgggatcatcgagccg
tctttgcggctcttggcccagaaatacaactgcgataaaatgatttgtcgcaaatgctat
gccaggttgcatccacgtgccaccaactgtcgcaagacaaagtgtggacacaccaataat
ctccgacccaagaagaagctcaagggttaa

DBGET integrated database retrieval system