KEGG   Tribolium castaneum (red flour beetle): 657050
Entry
657050            CDS       T01046                                 
Name
(RefSeq) guanylate cyclase 32E
  KO
K01769  guanylate cyclase, other [EC:4.6.1.2]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca00230  Purine metabolism
tca01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tca00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    657050
Enzymes [BR:tca01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     657050
SSDB
Motif
Pfam: Guanylate_cyc PK_Tyr_Ser-Thr Pkinase ANF_receptor HNOBA
Other DBs
NCBI-GeneID: 657050
NCBI-ProteinID: XP_008199208
Position
LG8:complement(941400..989683)
AA seq 966 aa
MDNIVADTYMKTRVYVFVGEHIALIDFIKCLQRRKLLDTGDYVVISVDDEIYDPNRRIKI
IRRDYLDPFLNETWGNVSDVMGFRSVLKLTPSHPRNPKYKYVCEKIKASSAKPPFCVPYH
HKIFDSISVPIQAAYLYDAVMIYARALTEVFQNNEDPRNGTAVLRRIVNRSYHSIQGYDV
FIDGNGDAEGNFTVVALLDDQEMNGTLRMSMQPVGYFQYKSNGSNVPSALPVREFRYLDV
DRPIQWVGGKLPRAEPRCGFNGEKCIYRIDWRFLASVSLMSLIVLIGILFCVKHYRYEHK
LACLLWKIDMRDVTIIPTETTELSNKSMIQVCRHSVFQAPSSSLAELAESSPKRAYTDIG
LYKGNIVAIKYLKKRSVDLTRSIRKELKQIREVRHENLIPFIGASVDHGNVAILTAYSAR
GSLEDVLANEDLHLDNMFVSSLVTDILKGMIYLHDSDIISHGNLRSSNCLIDSRWVVQIT
DFGLHEFKACPEGAETQSKKLKRSLWRAPELLRDPSPPARGTQKGDVYSFGIVLYEIIGR
RGPWGDTNIEPSEILRQVIEVKEVPLRPPLENLGAADYIIKCMKACWHEEPDQRPDIRFV
RVRLKEMQAGLKPNIFDNMLAIMEKYAYNLEGLVQERTNQLTEEKKKTEALLHRMLPKSV
AEALKRGDRVEAESFDCVTIYFSDIVGFTELSAVSTPLQVIDLLNDLYTCFDSIISHYDV
YKVETIGDAYMVVSGLPIRNGDRHAGEIASMALHLLSNIRKFEIKHRQGEVLQLRIGIHS
GHCVAGVVGLKMPRYCLFGDTVNTASRMESSGEAFKIHISHATYNLLQNLGGYRCEERGV
IPIKGKGEMRTYWLVGEDPAQRLARIREEIVGSSLFSSSDRLSETPDLLRRPGANFLIDG
VQFPQASCPLLQLHQRARLAYSMHYSQENLTAGDLERHLFQSQCCSNRNPRSAPAITFTD
LNYRYM
NT seq 2901 nt   +upstreamnt  +downstreamnt
atggacaatattgtcgcggatacatacatgaaaacacgagtatatgttttcgtgggagag
catattgccttaatcgacttcatcaagtgtttacaacggcgtaaactcctggacacgggg
gattacgtggtgatttcggttgacgacgaaatatacgatcccaaccgaagaattaaaatc
atacgaagagattacctcgatccctttctgaatgaaacgtggggtaatgttagtgacgta
atgggttttagatcagtgctcaaactcacgccgtctcatcctagaaatcccaagtataaa
tatgtgtgcgagaagattaaagcctcttcagccaaaccacccttttgtgttccataccac
cataagatctttgacagcatatcggtccccatccaagcggcttatttatacgacgccgtt
atgatttatgctcgagctttgactgaagtctttcaaaacaacgaagatccgcggaatgga
acagcagttctccgtcgaatagtcaatagatcttaccattccattcaaggatatgatgtt
tttattgatggaaacggcgacgccgaaggcaatttcactgtggtcgctttactggacgac
caagaaatgaacggaacgttgcggatgagcatgcaaccagtgggttattttcagtataaa
tccaacggaagcaacgtgccatcagcactccccgtaagggagttccgatatctggacgtc
gatcggcccattcagtgggttggtggaaagctgccgagagcagagcctcgatgtggtttc
aacggtgagaagtgtatttataggatcgactggcgattcctcgcaagtgtttccttaatg
tccctcattgtcctgatcgggattcttttttgtgtaaagcactatcgttacgaacacaaa
cttgcttgcctcttgtggaaaattgacatgcgagacgttacaataatccctacagagaca
acggaattgtccaacaaaagcatgatccaagtttgccgtcacagcgttttccaagcccca
agtagcagtttagccgaattagccgaatcctcaccaaaacgagcatacacagatataggt
ttatacaaaggcaacatagttgcaataaaatatttaaagaaaagatcagtcgatctcacg
cgttctatacggaaagaactgaaacaaatccgagaagtgagacatgaaaatcttatccct
tttatcggtgcaagtgtggaccatgggaacgtggcaattttaacagcttatagtgcgaga
gggagtcttgaagatgttttggccaatgaggatcttcatttggacaatatgtttgtttct
tctttagttacagacatccttaaaggaatgatctaccttcatgatagcgacattatatca
catggtaatctaaggtcgagcaattgtttaattgacagcagatgggttgtgcaaatcaca
gattttggtttacatgaatttaaagcatgtcctgaaggtgccgaaacacaaagtaaaaaa
ctgaaacggtctctatggcgagctccagaattgttgagagatccttcaccacctgctcga
ggaacacaaaaaggcgacgtttattcgtttggaatcgttttgtatgaaattattgggagg
aggggtccttggggtgacacaaatatagaaccatcagaaattctacggcaagttatagaa
gtgaaggaagtaccattgcgaccccctcttgaaaacttgggagctgcagattatatcatc
aaatgtatgaaggcttgttggcatgaagaaccggaccaaaggccagatattagatttgtt
agagtgagacttaaagagatgcaagctggtctgaaaccaaacatttttgataacatgtta
gcaattatggagaaatatgcttataatttagaagggttagtgcaagaaaggaccaatcag
ttgactgaagagaaaaagaaaaccgaagctttgcttcatagaatgctaccaaagtctgtg
gcagaagctctaaaacgaggcgatcgtgtcgaggctgaaagtttcgattgtgttacaatc
tacttcagtgacattgttggttttaccgaattatctgcggttagcacaccgctgcaagta
atagatttgctcaacgacctttacacttgttttgattctattatttcacattacgatgtt
tacaaggtagaaacaatcggagatgcttacatggtagtcagcggtttgcctataagaaac
ggggaccgccatgcgggagaaatcgcgtcaatggcgctccacctactcagcaatatacga
aaatttgaaatcaaacacagacagggtgaagtcctccaactgagaattggtattcactca
ggacattgtgttgctggagtcgttggcctaaaaatgccgagatattgtctgttcggagac
acagtgaatacagcttcgcgaatggaaagttctggtgaagctttcaaaattcacatatcg
catgccacttataaccttttacaaaacttgggtggctatagatgcgaagaaagaggcgtt
attccaattaagggaaaaggcgaaatgcgcacttattggttagttggtgaggacccggcc
cagcgattggcccgaattcgtgaagaaatcgtcggttcatcgcttttcagcagctcagac
agattgagcgaaactcctgatttacttcgacgtcctggtgccaatttcctaattgatgga
gtgcaatttcctcaagcgtcttgccctttattgcagttgcatcaaagagcaagattggcg
tattcgatgcactatagtcaggagaatttaacagctggtgatttggaaaggcatctgttt
caatcacagtgttgcagcaatcgaaatccgaggtcagcaccggctatcacttttacagat
ctcaattatcgttacatgtga

DBGET integrated database retrieval system