KEGG   Tribolium castaneum (red flour beetle): 657168
Entry
657168            CDS       T01046                                 
Symbol
Oscp
Name
(RefSeq) oligomycin sensitivity-conferring protein
  KO
K02137  F-type H+-transporting ATPase subunit O
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca00190  Oxidative phosphorylation
tca01100  Metabolic pathways
Module
tca_M00158  F-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:tca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    657168 (Oscp)
SSDB
Motif
Pfam: OSCP
Other DBs
NCBI-GeneID: 657168
NCBI-ProteinID: XP_968733
BEETLEBASE: TC000462
UniProt: D6WA56
Position
LG2:complement(10998409..10999391)
AA seq 209 aa
MATNKLSMLVRSFSTSNVASQMVKPPVQVFGIDGRYATALYSAASKQKTLDSVEKDLLKF
QSAIKSDPKLREFIKNPTIKRGLKSEALKQIASKISLNAQTSNLLQTLADNGRLKNLDGV
INAFKVMMAAHRGEVTCEVITARDLDAAQKSKLESVLKSFVKSSETIQLSTKVDPSIIGG
MIVSIGDKYVDMSVASKIKKYTEVISTPV
NT seq 630 nt   +upstreamnt  +downstreamnt
atggccacaaataagctctcgatgcttgtccgctccttcagcactagcaatgtcgcaagt
cagatggttaagcctccggtgcaggtctttggcattgacggacgttacgccaccgccctg
tactcggctgccagcaagcaaaaaaccctcgattctgttgaaaaagacctcctaaagttc
cagtcagctatcaagtctgaccccaaattgagggaatttatcaagaaccccacaattaag
cgcgggctgaaatccgaggctttgaaacaaattgcctcgaaaatatcgcttaacgcgcag
acgtccaatcttttgcagactcttgccgataatgggcgtctgaagaatttggatggggtt
atcaacgcctttaaggtcatgatggcagcccatcgtggagaggtgacttgtgaggtcatc
acagccagagacttagatgctgcgcaaaagtctaagttggaatcggtcttaaaatcgttc
gtgaagtcaagcgagaccattcagttgagtaccaaagttgatccctctatcataggagga
atgatcgtcagcattggtgataaatacgttgatatgagcgtcgctagcaaaatcaagaag
tacacagaagtcatttccactcctgtttaa

DBGET integrated database retrieval system