KEGG   Tribolium castaneum (red flour beetle): 657174
Entry
657174            CDS       T01046                                 

Name
(RefSeq) neutral alpha-glucosidase AB
  KO
K05546  mannosyl-oligosaccharide alpha-1,3-glucosidase [EC:3.2.1.207]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca00510  N-Glycan biosynthesis
tca01100  Metabolic pathways
tca04141  Protein processing in endoplasmic reticulum
Module
tca_M00073  N-glycan precursor trimming
Brite
KEGG Orthology (KO) [BR:tca00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    657174
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    657174
Enzymes [BR:tca01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.207  mannosyl-oligosaccharide alpha-1,3-glucosidase
     657174
SSDB
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2 DUF5110 AGL_N
Other DBs
NCBI-GeneID: 657174
NCBI-ProteinID: XP_008191077
Position
LG3:complement(8006887..8012744)
AA seq 909 aa
MFMLQSFMYGFLILLILATTSAVDKNNFKSCGQSSFCRRLRNFKPGTISYVLNLDTLHVG
DNSIEADLKNVEAEADFRFTLTSLAGNIFRVFIDEVKPLHPRYQVQGALNGEPQVAKLEV
LERTKDKVTVRSGDNKAVVTANPIKVEFFKNDALVAVINEKGLFNMEHLRAKPAEGEGEG
EQEVKEDPGAWEENFKSHHDSKPRGPEAVGVDVTFPGAFRIYGLPEHADRLALRSTGPGG
LDPYRLYNLDVFEYEVDSTMAIYGAVPVVYAHSDKNTVGVFWHNAAETWVDISNSKDTNV
VSSIVNLVSGHQPDNAVDAHFMSESGVFDMFVLMGPKPKDAVRQYASLTGVAPLPQYFAL
AYHQCRWNYNDETDVINVIDNFDLNELPVDVIWLDIEYTDGKKYFTWDPVKFAHPSEMIS
NLTSTGRKLVVIIDPHIKREGGYFLHEDCLANDYYVKNKDGNVYEGWCWPGSSSYPDLLD
PKVQEYYKGLYALDKFKGTTQDVHIWNDMNEPSVFNGPEVTMPKDCKHYGGWEHRHIHNI
YGLLYTEITYAGLIKRSSDRRPFILTRSHFAGSQRTAAVWTGDNAAEWSHLQASFPMCLS
EALGGISFCGADIGGFFNNPDTELLQRWYQTGIWLPFYRAHAHLDTRRREPYLFNEDVRT
RIRNALRLRYAILPLFYTLFREHETTGEPVIRPLFYEYPTDTNVIDIDDQLLVGDRILAR
PVTESGVSSVSVYLPGGPEQFWYDIEDFKQYHGTGVVNIPVTLDKIPAFYRGGTITPRKD
RPRRSSTLTHHDPYTLYVALDNNKSASGTLYVDDGESFGYRNKKYLYLNFEFKDNTLTSS
LIDKTDFPTDAWIERVVILGPPEKITKAILTSNSLGTVNLETSYDGENRSLVVRKPGVNV
REPFTLKLH
NT seq 2730 nt   +upstreamnt  +downstreamnt
atgttcatgttacagtcatttatgtacggtttcttgattttattaatactcgcaacaaca
tcagcggtcgacaaaaacaattttaaatcatgcggacaaagtagtttttgcaggcgcttg
agaaatttcaagcctggaacgatttcctacgttttaaatttagacactttacacgttggt
gataactcaatagaggccgatttgaaaaatgtggaagccgaagctgattttagattcact
ttgacttctcttgctggaaatatattcagggtgtttattgatgaagtcaagcctttgcat
ccccggtatcaagtacagggggcacttaatggcgagccacaagtggccaaattggaagtt
ttagagcgcacaaaagacaaagtaacggtacgttcaggcgataacaaagcagtcgtcaca
gcaaatcctattaaagttgagtttttcaaaaatgacgcccttgtggctgttatcaatgag
aaggggttattcaacatggaacatctcagggctaagcctgccgaaggtgaaggggaaggg
gaacaagaggtgaaggaagaccccggcgcttgggaagaaaatttcaagtctcatcatgac
tccaaacctagaggacctgaagcagtgggtgttgatgtcacttttccaggagccttcagg
atttatgggctgcctgaacatgcagataggttggctttgaggagcacggggcctgggggg
cttgacccttaccgcttgtacaatttggacgtttttgagtatgaagttgactccactatg
gccatctatggtgctgtcccggtggtctatgctcattcagacaaaaacacagtgggcgtt
ttctggcacaacgccgccgaaacctgggtagacatcagcaacagtaaagacacaaacgtt
gtttcctccatcgtaaacctggtctcaggccaccagcctgacaacgccgttgacgctcat
ttcatgagcgagagtggcgttttcgatatgtttgttttaatgggacctaagccgaaagat
gccgtacgacaatacgcctctttgaccggtgttgcccccttaccacaatactttgcacta
gcctaccaccagtgccgttggaactacaacgacgaaactgacgtgattaacgtcatagat
aatttcgatctcaatgagttacctgtcgatgttatctggctagatattgaatacaccgat
gggaaaaaatatttcacgtgggatccggttaagtttgcacatccgagcgaaatgatttcg
aatttgacatcaactggccgaaagttggtcgttattattgatccgcatattaagcgagag
ggtggttatttcctccatgaggactgtctagccaatgactattacgttaaaaataaagac
ggcaatgtttacgaaggttggtgctggcctgggtctagtagttacccggatttgctcgat
cctaaagtccaggagtactacaaaggtttgtacgctctggataagttcaaagggacgact
caagacgtccacatttggaacgatatgaacgaaccgtcggtttttaacggaccggaggtc
acaatgccgaaagattgcaaacattacggaggctgggaacatagacacattcacaacatc
tacgggttgctttatactgaaatcacttatgccggtttgattaagcggtcaagtgaccgc
aggccgtttattttaacaaggagtcactttgccggatctcagagaactgcagctgtttgg
actggagataacgcggcagaatggtcgcatctccaggccagttttccaatgtgtttatcc
gaggctttgggagggattagtttttgtggggctgatattggaggcttctttaataatcct
gataccgagttgttgcaaaggtggtaccagaccgggatctggttaccattttaccgtgcc
catgcccatctggacacaagacgtcgcgaaccttaccttttcaatgaagatgttcgtact
agaatccgaaacgctttgagactacgttatgccattttgcccctgttttacaccttgttc
agggaacatgaaacgacaggggaacctgtgataaggccactattttacgagtatcctact
gatactaatgttatcgatatcgacgaccaacttctagtcggtgaccggattttggcccga
cctgtgacggagtccggcgtgtcttccgtcagtgtttacctgcctggaggtcctgaacaa
ttttggtacgatattgaagatttcaaacaatatcacggaactggcgttgttaacataccg
gtgactttagataagattcctgcgttttataggggtggcactatcaccccacgtaaagat
aggccgaggaggtcgtccactttaacacatcatgatccttacacactttacgttgcattg
gacaacaataaatctgcgtccggtacgttgtatgtagatgacggtgaaagttttggttat
cgtaataagaaatacttgtatttgaacttcgagtttaaggacaatactctgaccagcagc
ttgattgataaaactgatttccctactgatgcctggatcgagcgagtggtcattttagga
ccgcctgagaaaatcaccaaggctattttaacgagcaatagcttaggtactgttaatttg
gaaacttcttacgacggtgaaaatcggtccttggtcgttcgtaagcctggtgttaatgtt
agagagccgtttacgttgaaacttcattaa

DBGET integrated database retrieval system