KEGG   Tribolium castaneum (red flour beetle): 657317
Entry
657317            CDS       T01046                                 
Name
(RefSeq) AP-3 complex subunit mu-1
  KO
K12398  AP-3 complex subunit mu
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca04142  Lysosome
Brite
KEGG Orthology (KO) [BR:tca00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    657317
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tca04131]
    657317
Membrane trafficking [BR:tca04131]
 Endosome - Lysosome transport
  Others
   AP-3 complex
    657317
 Endosome - Golgi transport
    657317
SSDB
Motif
Pfam: Adap_comp_sub Clat_adaptor_s
Other DBs
NCBI-GeneID: 657317
NCBI-ProteinID: XP_968876
UniProt: D6X4J2
Position
LG10:5431102..5436529
AA seq 415 aa
MIHSLFIINSSGDVFLEKHWRSVISRSVCDYYLEAQRANPNDIAPVIATPHHYLISIQRS
GVSFVAVCMEEIPPLFVIEFLHRVVDTFQDYFSDCTESIIKENYVVIYELLDEMLDNGFP
LATESNILKELIKPPNILRTIANTVTGKTNVSEVLPTGQLSNIPWRRTGVKYTNNEAYFD
VIEEVDAIIDKSGSTVFAEIQGYIDCCIKLSGMPDLTLSFMNPRLFDDVSFHPCVRFKRW
EAERVLSFIPPDGNFRLISYHISSQSVVAIPIYVRHNLSIKSGEQGRLDLTVGPKQTLGR
TVEAVKIEVLMPKCILNCVLTANQGKYNFDPVSKILHWDIGRIDVTKLPNIRGSVSIASG
ANTAEINPSINVHFTINQLAVSGLKVNRLDMYGEKYKPFKGVKYITKAGRFQIRM
NT seq 1248 nt   +upstreamnt  +downstreamnt
atgattcacagtttgtttattattaattcgtcaggtgacgttttcctggaaaaacattgg
cgcagtgtgatttcacgatcggtttgtgactattatttagaggcccaaagggcgaacccg
aatgacatagcccccgtgatagccaccccccatcactacttgatctcaatccagcgaagt
ggtgttagttttgtcgccgtgtgtatggaggagatccccccattattcgtgattgaattt
ttgcacagagttgttgacacgttccaagattatttctccgactgcaccgaatcgataatt
aaagagaattatgtcgtaatttacgaattgctagacgaaatgttggataatgggttccct
ctcgcaactgagagtaatattttgaaagaattaatcaagccgcctaatattctacgaaca
attgccaacactgtcacagggaaaaccaatgtgagcgaagtattgccaactggacaattg
tcaaatattccatggcgacgtactggagtcaaatacacaaataacgaggcctactttgat
gtgatcgaagaagtcgacgcgattatagataagtcaggctccacggtttttgccgaaatc
cagggttatatcgactgttgcatcaaactgagcggcatgcccgacttgactctttcgttc
atgaacccgcgccttttcgacgacgtcagtttccacccttgtgtgcgttttaagcggtgg
gaggccgaacgagtgttgtcatttattccaccagatggcaatttccgcctcatttcgtac
cacataagcagtcaaagcgtcgtcgcgatcccgatttacgtccgacacaacctgtcgatc
aaatcgggagagcaaggacgtctggacttgacagtgggccccaaacagaccctggggcga
acggtcgaggccgttaaaatcgaggtgctgatgccgaaatgcatcctcaattgtgtgctc
actgcgaatcaggggaagtacaactttgacccggtttcgaaaattttgcactgggatatt
ggcaggattgacgtcaccaaactgccgaatattaggggaagtgtgtcaatcgccagtggg
gccaacactgcggagattaatccgtccataaatgtgcattttacgataaatcagctcgca
gtgagcggattgaaagttaatagacttgacatgtatggagagaagtataagccttttaag
ggggtgaaatacataacgaaagcgggacgattccaaatcaggatgtga

DBGET integrated database retrieval system