KEGG   Tribolium castaneum (red flour beetle): 657421
Entry
657421            CDS       T01046                                 
Name
(RefSeq) LIM domain kinase 1
  KO
K05743  LIM domain kinase 1 [EC:2.7.11.1]
Organism
tca  Tribolium castaneum (red flour beetle)
Brite
KEGG Orthology (KO) [BR:tca00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tca01001]
    657421
Enzymes [BR:tca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     657421
Protein kinases [BR:tca01001]
 Serine/threonine kinases: TKL group
  LISK family [OT]
   657421
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase LIM Kdo PDZ RIO1 APH ABC1 PDZ_6 Pkinase_fungal Haspin_kinase B2
Other DBs
NCBI-GeneID: 657421
NCBI-ProteinID: XP_008194936
UniProt: D2A3V3
Position
LG6:7734168..7744104
AA seq 874 aa
MQEQPQNDGGPDNVCAGCLNVLDEEDVISALNQEWHLECFRCSACDASLSNWYFEKDGLL
FCKDDYWSRYGESCQQCGQIITGPVMVAGEHKFHPECFCCVSCGAFIGDGDSYALVERSK
LYCGQCYKRQMQPLKRNTRCPFIRKPHSIRLVEIPGGQKGIKLSKDSGNKCLISEKIRGK
LLRLALAFLTNAINTCCLFLPHRLDMNDDLMSLHIGDKILEINGTPVRDTAIDTVENLLK
YSDTVLQLTIEHDPDTLKPITPTVLAPQTLPLTTTSSDTNIPTTKNIPEPNLGGSTGDIP
CPEGGKPANKERLFKRRDEGYMSGTRSRQLRRKNHLSDNRQLDKERSSSMSRLLDEAPNS
KRCLELSRAYSFLESRPPQRVFRASDLVKGELLGQGFFGQVFKVTTRDTAEVMVLKELYR
VDEEAQKNFLKEVAVLRSLHHNNVLRFIGVLYKERRLHLVTEYISGGTLTELIHDTSQPL
PWEQRVSFAKDIAAGMAYLHSMNIIHRDLNSHNCLVREDKTVIVADFGLARIVSHTTNSA
TRMSPKRQERKKRYTVVGNPYWMAPEMMKGNKYDEKVDIFSFGIILCEIIGRVLADPDFL
PRSNDFGLNQMTFKEKFCASCPEAFYKIAFLCTDLNPDKRPPFEVMEVWLESLSMHLSVG
MPLPPDLLFDIQHYRGISPSSSGSNTPDSISGHRSPALEPIKEGKTTEKPKVETVEYPNY
ENVEFVKTDKAANNVKTSNKYLGSKKPEPKNLSLQSISLNTMCPSRVTQKFVNNSIVQKK
SIPDVVSSTLTKNPDYNNLCSSRRRYMRISGTPLMSRRKPCEPPESGASVVRTIIDNFNK
KELDRGAYGRCSLRVTGSKKLGGRSDSPDEYTPL
NT seq 2625 nt   +upstreamnt  +downstreamnt
atgcaagaacagccccaaaacgatgggggccccgataacgtctgcgccggttgtcttaac
gtgctggacgaagaggacgtcatcagtgccctcaatcaggagtggcatttggaatgcttt
cgttgttcggcatgcgacgcgtccttgtccaattggtactttgaaaaggacggtcttttg
ttttgcaaagatgactattggtctcggtatggggagtcctgtcaacagtgcggccaaatt
atcacagggccggttatggtagctggggaacacaaatttcacccagaatgcttctgttgc
gtctcgtgtggggctttcatcggcgatggggactcttacgccctcgtcgaacgctccaaa
ctgtactgcggacagtgctacaagcgccagatgcagccgctcaaacgcaacaccagatgt
cccttcatccgcaaaccgcactcaatcagactggtggaaataccaggtggccaaaaagga
atcaaactatcaaaggattccggaaacaaatgcctaatttcagagaaaatacggggaaaa
ttgcttcgactggctttggcttttctaacaaatgcgattaacacctgttgcttgtttttg
ccccatagacttgacatgaatgacgacttgatgtcgcttcacattggcgataaaatactc
gaaattaatggaacaccagtcagggacactgccatcgacacggtcgaaaatttactaaaa
tattcagacacagtccttcaactaaccatagaacacgatcctgatacgctaaaaccaatc
actccaactgtgttggcacctcagacacttccactcactacaacgtcaagtgataccaac
attcccacaacaaaaaacatacccgagccaaatcttggcggctcaactggtgacattcca
tgtccggagggtggcaaacctgcaaataaggagcgcttgtttaaacgacgtgatgagggt
tatatgagtgggacacgatcaagacagctgcgacgtaaaaatcacctgtctgacaatcgc
caacttgataaagaacgcagttcgtcgatgagtaggctactagatgaggcgccaaattcc
aaacgttgtcttgaattatctagagcgtattcgtttctcgaatcacggcctcctcagcgt
gttttccgcgcttcggacctcgtcaaaggcgaactcctcggtcagggtttcttcggtcag
gtgtttaaggttacgacacgtgatacggccgaagttatggtgcttaaagaattgtatcga
gtggatgaagaggcacagaagaattttctcaaagaggtggccgttttgcgtagtttgcat
cacaataacgtgcttcgtttcatcggtgttttgtataaagagcggcgacttcatttggtc
actgagtatatatctgggggtacattgacggagttgatacacgatacgtctcagccgctc
ccatgggagcagcgagtgtcgtttgcgaaggatatcgcagcaggcatggcctacttgcat
tcgatgaatatcattcatagggacttgaattcgcataattgtttggtgagggaggataag
actgtgattgttgcggattttggtttggcgagaattgtgtcgcatacgaccaatagtgcg
acaaggatgtcgcctaaaagacaggagagaaaaaagaggtatactgttgtggggaatccc
tattggatggcgcccgagatgatgaaagggaataaatacgatgagaaagtggatattttt
agttttgggattattttgtgcgagattattgggcgcgttttggccgaccctgacttcctg
ccccgttcaaacgactttggcctcaaccaaatgactttcaaggagaaattctgtgcttct
tgtcccgaagccttctacaaaattgcatttctatgcaccgatctcaatccggataagcgg
ccgccatttgaggttatggaagtttggttagaaagcctctccatgcatttatcagtggga
atgcctctcccacctgatttactcttcgatatccaacactacagaggcataagccccagt
tcgtctggtagtaacacccccgatagcatttcgggccaccgcagtccggccctggaacca
atcaaagagggcaaaacgaccgaaaaaccgaaagtcgaaaccgtcgaatatccgaattac
gaaaacgtcgaatttgtaaaaaccgacaaggctgccaacaacgtaaaaacgtcgaataaa
tatttggggtctaaaaaaccggagccgaaaaatttgagtctccaaagtatcagtttgaat
acgatgtgcccctctcgagtgacccaaaaattcgttaataattctatagtacaaaagaaa
agtatcccagatgtggtttcgtccacattgaccaaaaaccctgattataataatttgtgt
tcgtcccggaggcgttatatgaggatctcggggacccctttgatgtcgcgacggaagccc
tgcgagccccccgaaagtggggcttccgtcgtgcggaccattatcgataattttaataag
aaggagttggacaggggggcttacggtaggtgctcgctgcgggtgaccgggagtaagaag
ctgggggggcgcagcgacagccccgatgaatacacacccttgtaa

DBGET integrated database retrieval system