KEGG   Tribolium castaneum (red flour beetle): 657465
Entry
657465            CDS       T01046                                 

Name
(RefSeq) heterogeneous nuclear ribonucleoprotein A1, A2/B1 homolog
  KO
K12741  heterogeneous nuclear ribonucleoprotein A1/A3
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:tca00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    657465
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:tca03019]
    657465
   03041 Spliceosome [BR:tca03041]
    657465
Messenger RNA biogenesis [BR:tca03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Other transport factors
     657465
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     657465
Spliceosome [BR:tca03041]
 Common components
  Common spliceosomal components
   hnRNP proteins
    657465
SSDB
Motif
Pfam: RRM_1 RRM_7
Other DBs
NCBI-GeneID: 657465
NCBI-ProteinID: XP_008200838
Position
LG2:complement(2565361..2573970)
AA seq 322 aa
MMRRDGEDSNDNKPEHEQYRKLFIGGLDYRTTDESLKKHFEKWGEIVDVVVMKDPTTKRS
RGFGFITYSRAHMVDDAQNDRPHKVDGRVVEPKRAVPRQDIGRPEAGATVKKLFVGGLKD
DVEEEDLRECFKSYGTILSCTIVTDKDTGKKRGFGFIEFEDYDPVDKICLYRHHQIHGKH
IDVKKALSKAEMDRANQGGGNMGGGGGPRGGRGGGRGNYSGGGGGGNWNRGGPSGDWNNS
QGGYNSGNSWGNNPWDNQSGNNWGGAQSSGYNSGANWGGSNDNYSGGYQQNYGGGPVRNN
YQQNRPAPYKSLKAIDSRKKMD
NT seq 969 nt   +upstreamnt  +downstreamnt
atgatgcgtcgcgacggtgaagactccaatgacaacaaaccggaacatgaacagtaccgc
aaattattcatcggcggtttggattatcggacaaccgatgaatcgctgaagaaacacttt
gaaaaatggggcgaaatcgtcgatgttgtcgtaatgaaggacccaacaacaaagcggtcg
cgcgggtttggcttcattacgtattccagggcacacatggttgacgacgcccagaacgat
cgcccccataaagtcgatgggcgggtggtcgagcccaagcgagccgtcccaagacaggac
atagggaggcccgaagcgggggccactgtcaaaaaactattcgttggggggttaaaggac
gacgtggaggaggaggatctaagggagtgtttcaaatcttatggtaccatcctgtcttgt
accatcgtcactgataaagacaccggcaagaagcgcggatttggatttattgaattcgag
gattatgaccctgttgataaaatttgtttgtaccgccaccaccaaatccacggcaagcac
atagacgtgaagaaggctttgagcaaagcagagatggaccgtgcgaaccaaggaggcggc
aatatgggcggtgggggcggtccgcgtggaggccgtggcggcggccggggcaattacagc
ggcggcggcggcggcggtaactggaatcgtgggggccctagcggcgattggaacaactcg
caagggggctacaacagcgggaattcgtggggcaacaacccttgggataaccaatctggt
aacaattggggcggtgctcaaagttcggggtacaattctggggcgaattggggcggttcc
aatgataactacagcgggggttatcagcagaactacggagggggccctgtgcgcaacaac
taccaacagaacagaccagcaccttacaaatcgttaaaggcaattgatagcaggaagaaa
atggattaa

DBGET integrated database retrieval system