KEGG   Tribolium castaneum (red flour beetle): 657478Help
Entry
657478            CDS       T01046                                 

Definition
(RefSeq) protein IWS1 homolog
  KO
K17498  transcription factor SPN1
Organism
tca  Tribolium castaneum (red flour beetle)
Brite
KEGG Orthology (KO) [BR:tca00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:tca03021]
    657478
Transcription machinery [BR:tca03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     657478
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Med26
Motif
Other DBs
NCBI-GeneID: 657478
NCBI-ProteinID: XP_008191768
Position
LG3
AA seq 734 aa AA seqDB search
MDVETEGTDAKEPSSPALSNCSRSRSRSVEKNVSNGVSSPAHSTGSGSRKSASRSRSRSR
SPQMNGDTSRNSKSRSRSGSPAGRQSRSRSRSGSARSGSRSPSGSPRRSRSRSASQGSRK
AASRSKSRSRSRSGTPAQRNSRSRSPSGSRKGSRSRSRSGSAKSVGSRKSRSRSGSAKSV
HSRKSRSRSGSAKSAGSRRSRSRSGSAKSVGSAKSGGSRRSRSRSGSAKSGGSRRSRSRS
GSAKSGGSRRSRSRSGSAKSAGSRKSRSRSGSARSNKSGSRSRSRSRSRSGSRSGSARSR
SGSRRSRSGSARSRSGSRSRSRSGSRRSRSGSRSRSRSASGSRKSRSRSRSRSGSAKSRS
RSRSGSYSGNEGGVGRKRRLVSDSEDEGEGPPKAKRAVVSDDEGGEPSEEKKIGGEPEEA
GNEVVPDVSEDSDDEDRPTHESNDGLSDFEVMLQRKREEQSKKRKRKDIDIINDNDDIIA
QLLADMRNAAEDDRRLNQLSQPATKKIAMLSKVMSQLKKHDLQLAFIEHNVLSVLTDWLA
PMPDRSLPSLQVREAILKLLADFPKVDQSTRKHSGIGKAVMYLYKHPKETKENKERAGKL
ISEWVRPIFNLSADFKAMTREERLQRDLEQIPKRGRNEQQSSSERKELTKALNSEGKPLR
PGEKGWVARARVPMPSNKDYLVRPKWTSEVDISRSSKKQMNRFEKHYKNFLDGKRLKQPR
RAVEISIEGRNMAL
NT seq 2205 nt NT seq  +upstreamnt  +downstreamnt
atggatgttgagactgaaggaacagatgctaaagaaccatcttcgccagctttgagcaac
tgctcgcgttcccgttcgagatccgtggaaaaaaatgtatcaaatggcgtctcgtctcca
gctcattccacaggatctggatcccgtaaatccgcatccaggtcgcgatccagatcacgt
tccccgcaaatgaacggagacacttctcgtaactccaaatccaggtccagaagcggctct
ccagctggacgccaatccagatcaagatccaggtctggcagcgcacgctctggctccaga
tccccctcaggatcaccgaggcgatcacgatcacgatccgcgagtcaaggatcacgcaaa
gcagcttcacgatcaaaatcccgctccagatccagatcaggaacccccgcacaacgtaat
tccagatctagatcgccctcaggctccagaaaagggtcgcgttcgaggtcacgctcgggt
tcggccaaatcggttggctctcgaaaatcacgctcacgttcaggttccgcaaaatcggtg
cattctcgaaaatcgcgctcacgttcaggttctgcgaagtcagctggttctagaaggtcg
cgctctaggtcaggttctgccaagtccgtgggttccgccaaatccggtggttccagaagg
tcgcgctctagatctggttccgccaaatccggtggttccagaaggtcgcgctctagatct
ggctccgcgaaatctggcggttccagaaggtcgcgttcaaggtcgggatccgccaaatcc
gcgggctccagaaagtcgcgttcaagatcaggttctgcgcgatctaacaagtcaggatca
cgatcacgttcaagatccaggtccaggtcgggttcgagatccgggtccgcgagatcacgg
tctggttctagaagatcgaggtccggatcggcacgctctagatccggttccagatcacgg
tctaggtctggatccaggcgttcgaggtctggctccagatcgcggtcgcgttctgcgtct
ggatcgcgcaaatcgcgttcgaggtcaaggtccagatccggatccgcgaaatcacggtca
aggtcgcgttccggttcgtattccggaaacgagggaggagttggtcggaaacgacgtttg
gtttccgactcggaggacgaaggtgaagggccaccgaaggccaaaagggcggtagttagt
gatgatgagggtggggaaccttcagaagagaaaaagatcgggggggaaccagaagaagct
ggaaatgaagtggttccggatgtgtctgaagattccgatgatgaggacagacccacacac
gaatcaaatgacggcttatccgactttgaggtaatgttacaacggaagcgagaagagcag
tctaagaaacggaaacggaaagacatagacatcattaacgacaacgacgacataatcgca
caattattagccgacatgagaaatgcagctgaagacgaccgaagactgaaccaactaagc
caacccgccactaaaaaaatcgccatgttaagcaaggtcatgtcgcagctaaagaaacac
gacttgcaattggctttcatcgaacataacgtcctcagcgtgttgactgactggttggcc
ccaatgcccgaccgttcgctaccctcgctgcaagtacgagaggcaatactaaaactccta
gcagacttcccgaaagtcgatcagtccactcgcaaacactccggaatcggcaaagccgtc
atgtatctctataagcacccgaaggagacgaaagagaacaaggagcgagccggcaagtta
atcagcgagtgggtgcgacccattttcaatctttcggccgactttaaagcaatgactcgt
gaggagcgccttcagagagacctggagcagattccgaagcgtgggcggaacgagcaacag
tcgtcctccgagcggaaggagttgacgaaagcgttgaattcggagggaaagcctctgagg
ccgggagaaaaggggtgggttgcacgggccagagttcctatgccttccaataaagattat
ctcgtgcggcctaagtggacatcggaggtggacatcagtaggtcgtcgaagaaacaaatg
aataggtttgagaagcattacaagaacttcctggacggcaaacgattgaaacaaccaaga
agagcagtagaaatatcgattgaagggcgaaatatggcgttgtaa

DBGET integrated database retrieval system