KEGG   Tribolium castaneum (red flour beetle): 657540
Entry
657540            CDS       T01046                                 
Name
(RefSeq) 60S ribosomal protein L35a
  KO
K02917  large subunit ribosomal protein L35Ae
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca03010  Ribosome
Brite
KEGG Orthology (KO) [BR:tca00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    657540
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:tca03011]
    657540
Ribosome [BR:tca03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    657540
  Archaea
    657540
SSDB
Motif
Pfam: Ribosomal_L35Ae
Other DBs
NCBI-GeneID: 657540
NCBI-ProteinID: XP_008195720
BEETLEBASE: TC002098
UniProt: D7EL35
Position
Un
AA seq 143 aa
MADAAAKKPKAAKKAKEGAENVAPKKRPHKRHGRLYAKAIFTGYKRGLRNQHENTALLKI
EGTNAKPDSWFYVGKKCVYVYKAKNKTCVPGKPKSVKSKVRAIWGKVTRPHGTSGAVRAK
FKRNLPAKAMGHRIRIMLYPSRI
NT seq 432 nt   +upstreamnt  +downstreamnt
atggcagacgcagcagcgaagaaacccaaggcggccaaaaaggcgaaagaaggcgcggag
aatgtcgccccaaaaaagcggcctcataagagacatgggaggttatacgcgaaagcgatt
ttcacgggttacaagcgcggccttcgcaaccagcacgaaaacacggcccttttgaaaatc
gaaggcacgaatgccaagcccgatagctggttctatgttggaaagaagtgtgtttacgtg
tacaaagccaagaacaagacttgtgtgcctggaaaacccaagtcggtgaagagcaaggtt
agggccatctggggcaaagtgacgagaccgcatggcaccagtggggccgtcagggccaag
tttaagaggaatttgccggcgaaggctatgggacatcgcattcgcattatgttgtatccc
tccaggatctaa

DBGET integrated database retrieval system