KEGG   Tribolium castaneum (red flour beetle): 657621
Entry
657621            CDS       T01046                                 
Name
(RefSeq) ubiquitin-like modifier-activating enzyme 1
  KO
K03178  ubiquitin-activating enzyme E1 [EC:6.2.1.45]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:tca00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    657621
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:tca04121]
    657621
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tca04147]
    657621
Enzymes [BR:tca01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.45  E1 ubiquitin-activating enzyme
     657621
Ubiquitin system [BR:tca04121]
 Ubiquitin-activating enzymes (E1)
  Ubiquitin activating enzyme
   657621
Exosome [BR:tca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   657621
  Exosomal proteins of other body fluids (saliva and urine)
   657621
  Exosomal proteins of colorectal cancer cells
   657621
SSDB
Motif
Pfam: ThiF UBA_E1_SCCH E1_UFD E1_FCCH E1_4HB DNA_methylase PAZ
Other DBs
NCBI-GeneID: 657621
NCBI-ProteinID: XP_966352
UniProt: A0A139WLH6
Position
LG3:complement(3827101..3833645)
AA seq 1041 aa
MSSAEIAEGSVDPPTKKRKLDSCPISTDMANNGASGSSQQDIDEGLYSRQLYVLGHDAMR
RMASSDVLVSGLGGLGVEVAKNVILGGVKSVTLHDEAVCSVADLSSQFYFTEADVGKNRA
EVCCKQLAELNTYVPTKAYTGPLTPDFIRKFRVVVLTNSCLAEQMQISEITHASNIALIV
ADTRGLFAQVFCDFGDAFTVVDTNGESPVSAMIADISTDKEGIVTCIDDTRHGMEDGDHV
TFSEVQGMTELNNCKPIKIKVLGPYTFSIGDTTNFSKYERGGIATQVKMPKTLSFKSLKD
SLKSPEFLMTDFAKFDHPQQLHVAFQALHKYVEKHGRVPKPWNNEDASEFLSIAKSLAVD
GGNDTEVNTNLLETFAKVCAGDLNPINATIGGIVAQEVMKACSGKFHPIYQWLYFDAIEC
LPTEAGEITEESAAPKGTRYDGQIAVFGSEFQKKLGGLKYFVVGAGAIGCELLKNFAMMG
IGGEGGQITVTDMDLIEKSNLNRQFLFRPHDVQRPKSGTAAKVIKKMNPSINIVAHENRV
GPESENMYDDTFFESLDGVANALDNVDARIYMDRRCVYYRKPLLESGTLGTKGNTQVVVP
FLTESYSSSQDPPEKSIPICTLKNFPNAIEHTLQWARDNFEGLFRQSAENASQYLTDPEF
LERTIKLPGVQPIEVLESVKAALVDDRPKSFEDCVVWARHHWEEQYSNQIKQLLFNFPPD
QKTSTGQLFWSGPKRCPEPLTFDVNNTLHLDYVFAAANLKAEVYGIPQNRDRAYIAEVVQ
KIHVPEFVPKSGVKIAVTDSQMAMTNGSSVDLDRVGQIREELPSVAELGNLCLTPLDFEK
DDDTNLHMDFIVAASNLRAANYKIPPADRHKSKLIAGKIIPAIATTTSVVAGLVCLELYK
LTRSLKSLTPFKNGFVNLALPFFGFSEPIAAPKNEYCGKEWTLWDRFEVDGEMTLSEFLE
YFKEKHGLEITMLSQGVCMLYSFFMAKAKAQERLGLPMSEIVKRVSKKKLEPHVKALVFE
LCCNDADGNDVEVPYVKYNLP
NT seq 3126 nt   +upstreamnt  +downstreamnt
atgtctagtgctgaaatcgccgaaggctccgtcgatcccccaactaagaagcggaagctt
gactcgtgcccgatttcaaccgacatggcgaacaacggcgcttccggatcgtctcagcag
gacatcgacgagggtctgtactcgcgccagctctacgtcctggggcacgacgccatgcgg
cgcatggcctccagcgacgtgctggtctcaggcctgggcgggctcggcgtcgaggtggcc
aagaacgtcatcctcggcggggtcaagtccgtcacgttgcatgacgaagccgtttgcagc
gtcgccgacctctcgtcgcagttctacttcaccgaagccgacgtgggcaagaacagggcc
gaggtctgctgcaagcagctggcggagctcaacacctacgtccccacgaaggcctacacg
ggccccctgacgccggacttcatccgcaagttccgagtcgttgtcctgaccaatagttgt
ctcgctgagcagatgcaaatcagcgaaatcacacatgccagtaacattgcgctcattgtg
gccgatacgagggggctctttgcccaagtgttctgtgatttcggggatgctttcacggtc
gttgacaccaacggggagtcgccggtctcggcgatgatcgctgatatttccaccgataaa
gaaggcattgtgacctgcattgacgacacccgccatggcatggaagacggcgaccacgtc
acattttccgaagtccaaggaatgaccgaactgaacaattgcaagccgattaaaatcaaa
gtgttaggcccttacacgttcagcatcggcgatacgaccaacttttcgaaatacgagcgt
ggcggtattgccactcaagtgaaaatgcccaaaaccttgtcgtttaaatcactcaaagac
tcgctaaaatcgcccgaatttttgatgaccgatttcgcgaaattcgatcatccacagcag
ctccacgtggcttttcaagcgttgcacaaatacgtcgaaaagcacggccgtgtaccaaaa
ccgtggaacaacgaagacgcatccgaatttctgtccattgctaaatctttggccgtggac
ggcggaaacgataccgaagtgaacactaacttgttagaaacgtttgcgaaagtgtgcgcg
ggtgatttgaatccgattaatgcgactatcggtggtatcgtggcgcaggaagttatgaaa
gcttgttcggggaaatttcacccgatttatcagtggttgtatttcgatgcgattgaatgt
ttgcccacggaagctggggaaattaccgaagagtcggcggcaccgaaaggcacacgctat
gatggacaaattgcggtcttcggaagcgaattccagaagaaattaggcggtttgaaatat
ttcgtagtaggtgctggagcgatcggttgcgaattacttaaaaatttcgctatgatggga
attggtggtgaaggtggacaaatcaccgtcactgatatggatcttattgaaaaatctaat
ctcaatcgacagtttttgttcagaccacatgatgttcagcgtcccaaatctggaacggca
gcaaaggtgatcaagaaaatgaacccgagcataaacatagtcgcccatgaaaatcgcgtg
ggccccgagtctgaaaacatgtacgatgacactttcttcgagtcgttagacggcgtagct
aacgctttagataacgttgacgctcgtatctacatggaccgtcgatgtgtctattaccga
aaacctctactagaatccggaaccttgggtacaaaaggcaacacccaggtcgtagtgcct
ttcctcaccgaatcctacagttcgtcacaggaccctcccgagaagagcatcccgatttgt
acccttaaaaatttccccaacgccatcgaacacactctccaatgggctcgtgataatttc
gaaggccttttcagacagagtgctgaaaacgcatcgcaatatctcaccgatcctgaattt
ttggaacgtactattaaattaccaggagttcaaccgattgaagtgctggaatcggtcaag
gcagctttagttgatgataggccaaagagttttgaagactgtgtagtgtgggcccgccat
cattgggaggaacaatattcaaatcagatcaaacaactgctttttaatttcccgccggat
caaaaaaccagcactggacagttgttctggtcgggaccgaagaggtgtcccgaaccactc
acattcgatgtgaacaataccttgcatttggattatgtttttgcagcggctaatttgaaa
gccgaggtttatggaataccgcagaatagggatcgggcttacatcgccgaagtggtgcaa
aaaattcacgtaccagagttcgtcccgaaatctggcgtcaagatcgccgtcaccgattcg
cagatggcaatgacgaacggttcaagcgtcgacttggaccgcgttggccaaatcagagag
gaattaccttcggtcgccgaactgggcaatctttgcctcactccacttgatttcgaaaag
gacgacgacacaaacctccacatggatttcatagtagcggcttcgaatctccgagccgcc
aactacaaaatccctccagccgatcgtcacaaatccaagctgatcgccggcaaaatcatc
ccagctatagcgacaacaacctcagtcgtcgccggcctcgtctgtctcgagctttacaaa
ttaacgagaagtttgaaatcgttgacgccgttcaagaacggtttcgtcaacttggctctg
ccgttcttcgggttttcggagcccattgccgcccccaagaacgagtattgcgggaaggag
tggacgttgtgggaccggtttgaggtggatggggagatgactctgagcgagtttttggag
tactttaaagagaagcacggcttggagatcacgatgttgtcgcagggcgtgtgcatgctg
tactcgttctttatggccaaagcgaaggcgcaggaacgcctggggttgcccatgtccgag
attgtgaagcgagtgtcgaagaagaagctcgaaccgcacgtcaaggcgctagtgtttgaa
ctgtgttgtaacgacgctgacggaaacgatgtcgaagttccgtatgttaagtataatcta
ccttga

DBGET integrated database retrieval system