KEGG   Tribolium castaneum (red flour beetle): 657702
Entry
657702            CDS       T01046                                 

Name
(RefSeq) 60S ribosomal protein L15
  KO
K02877  large subunit ribosomal protein L15e
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca03010  Ribosome
Brite
KEGG Orthology (KO) [BR:tca00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    657702
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:tca03011]
    657702
Ribosome [BR:tca03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    657702
  Archaea
    657702
SSDB
Motif
Pfam: Ribosomal_L15e
Other DBs
NCBI-GeneID: 657702
NCBI-ProteinID: XP_008193026
UniProt: D6X3S2
Position
LG10:complement(2345341..2351136)
AA seq 204 aa
MGAYKYIQELYRKKQSDVLRFLLRVRVWQYRQLTKLHRAPRPSRPDKARRLGYRAKQGFV
IFRIRVRRGGRKRPVPKGATYGKPKSHGVNQLKPVRNLQAIAEERVGRRCGGLRVLNSYW
VAQDSSYKYYEVILVDPSHKAIRRDPKVNWIVNSVHKHRELRGKTSAGRSSRGIGKGHRY
SQTKGGSRRAAWLRRNSLQLRRKR
NT seq 615 nt   +upstreamnt  +downstreamnt
atgggggcctacaagtacatccaagaattgtaccgtaagaaacaaagtgatgttcttcga
tttttgttgagagtgcgcgtttggcagtaccgccagttgacgaaattgcaccgtgccccc
agaccttcgcgtcccgataaggcccggagattggggtacagagccaaacaaggttttgtt
atatttcgcattcgcgttcgtcgtggaggccgtaagcgtcccgttcccaagggtgccact
tacggcaaacccaaaagccacggagtcaaccaactcaaacccgtgcgcaacttgcaagcc
attgctgaggaaagggttggaagacgctgtggtggtcttcgcgttttgaactcttattgg
gtggcacaagactcttcatacaaatactatgaagttattttagttgacccgtctcataag
gctattcgtcgcgatcctaaagttaactggatagtgaattccgttcacaaacatcgtgaa
ttgcgcggcaagacatctgccggacgttcctcccgaggtattggtaagggacacaggtat
tcacaaaccaagggaggttccaggagagccgcttggctcaggaggaactcgctgcaatta
cgcagaaagcgataa

DBGET integrated database retrieval system