KEGG   Tribolium castaneum (red flour beetle): 657737
Entry
657737            CDS       T01046                                 

Name
(RefSeq) ATP synthase-coupling factor 6, mitochondrial
  KO
K02131  F-type H+-transporting ATPase subunit 6
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca00190  Oxidative phosphorylation
tca01100  Metabolic pathways
Module
tca_M00158  F-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:tca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    657737
SSDB
Motif
Pfam: ATP-synt_F6 ATP_sub_h
Other DBs
NCBI-GeneID: 657737
NCBI-ProteinID: XP_008195395
UniProt: D6WSX9
Position
LG7:complement(3114922..3115589)
AA seq 108 aa
MLSSHLLNNIHRSVRATVHSRNIGILAPCLQKASDPIQQLFIEKIKEYKQKSGGGTKLVE
PSPEIERELKSELEKVAKVYGGGPGVDMTKFPTFKFTDPVIDPINLEK
NT seq 327 nt   +upstreamnt  +downstreamnt
atgttgtcttcgcatcttttgaacaatatccacaggtcggtccgtgccacagtccactca
cgcaacatcggaatcctcgccccctgcttgcagaaggcctccgacccgatccaacaactc
ttcattgagaaaatcaaagaatacaaacagaaaagtggaggtggcaccaaactcgtggaa
ccctcgcctgagattgagcgcgagctcaagtccgagctagagaaggtggccaaggtctat
gggggcggtcctggcgttgacatgaccaagttcccaacgttcaaattcacggatcctgtg
atcgatccaatcaacttggagaaataa

DBGET integrated database retrieval system