KEGG   Tribolium castaneum (red flour beetle): 657756
Entry
657756            CDS       T01046                                 

Name
(RefSeq) putative glycerol kinase 3
  KO
K00864  glycerol kinase [EC:2.7.1.30]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca00561  Glycerolipid metabolism
tca01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tca00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    657756
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tca04147]
    657756
Enzymes [BR:tca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     657756
Exosome [BR:tca04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   657756
SSDB
Motif
Pfam: FGGY_N FGGY_C
Other DBs
NCBI-GeneID: 657756
NCBI-ProteinID: XP_008194086
Position
LG3:20395958..20401432
AA seq 562 aa
MSDTREKYGPLIGSIDEGTSSTRFLVFASKTAEVLTYHQVKIPHITPKEGWFEQDPMQIL
NSVIETINVTCDNLKKLNINYEDIVATGITNQRETTILWDRTTGKPLYNALVWMDMRTSS
TVDSILLNGKRNKNFLQSMCGLPISTYFSALKIKWLMDNVDGVKKAMEEKRCLFGTVDTW
LIWNLTGGVKGGLHITDVTNASRTMLMNIETLKWDSYLCKVFDIPMHILPEIRSSSEIYG
YITDVTVLAGIPISGVLGDQQAALVGQMCFHQGQAKNTYGTGCFLLYNTGTTMVQSNHGL
LTTVGYKLGPDKPTVYALEGSIAIAGISIKWLQDNLMILKDSKDSGDIAASADEVGEVYF
VPAFSGLYAPYWRKDARSVICGLTEETKPEHLVKAALEAVCYQVRDILEAMALDCGYSLS
KLLVDGGMTANDFLMQMQADYCGIPVVRPTMAETTCLGAAIAAGNAKGVEVWDLDNIQPV
PSDTFLPSISDNQRDIKYARWKMAINRSLGWAQDEEEDNSFEELSDVDASITDDNMLTTL
PGGLYVLGTMVMLLVAEILEKK
NT seq 1689 nt   +upstreamnt  +downstreamnt
atgtctgatacaagagaaaaatatggcccactaatcggatcaatagatgaaggaacttca
agcacaaggtttttggtctttgcttccaaaacagcagaggtattgacctatcaccaggtt
aaaatcccacacattactccaaaggagggatggtttgagcaagatcctatgcagattttg
aattctgtgatagagaccatcaatgtaacttgtgataacttaaagaaacttaatattaat
tatgaggatatagtggctacgggtattaccaaccaaagagagaccacaattctttgggac
cgcacaactggcaaaccattatataacgctttagtatggatggatatgcgaacttcaagc
acagtagacagtattttgttaaatggaaagagaaataagaattttttacaaagtatgtgt
ggtctccctatcagcacatactttagtgctttaaaaatcaagtggttgatggataacgtt
gatggggttaagaaagcaatggaggagaaaagatgtctttttggaacggttgacacttgg
ttgatttggaatctaacaggtggtgtaaaaggtggcctacatataactgatgttaccaat
gcttcaagaacaatgttgatgaatatagaaacacttaaatgggattcttatttatgtaaa
gtttttgacattccgatgcacattttgcctgaaattcgaagttcttctgagatatatggc
tacataactgatgttacagtgttggctggaattccaatttcgggggtgttgggtgatcaa
caggcggctttagttggccaaatgtgttttcaccaaggtcaagccaaaaatacatatggc
actggctgttttctcttgtataataccggaactacgatggttcagtcaaaccatggtctt
ttaacaacagttggttataaattaggccctgataaaccaactgtttatgccttggaagga
tcaattgctattgcaggcatttcgataaaatggcttcaggacaatttaatgattttgaaa
gactcgaaagactctggagacattgccgcatctgctgacgaagtgggtgaagtttatttt
gtgccagcgttctctggtctttatgcaccttattggcgtaaagatgctagaagtgttata
tgtggtctgactgaggaaacaaagccagaacatttagtcaaagctgctttagaagcagtc
tgttaccaagtaagggatattttagaagcaatggcgttagactgtggttactctttatct
aaacttctagtagacggtggtatgacagctaatgattttttaatgcaaatgcaagctgat
tattgtggaattcctgtggtgcggcctactatggctgaaactacttgtttaggggcagct
atcgcagctggaaatgcaaaaggggttgaagtgtgggatttggataatatacaacctgtg
ccaagcgatacattcttaccgtcaatttctgacaatcaacgggatataaaatatgcacgg
tggaaaatggcaattaatcgaagtttagggtgggcacaggatgaggaagaagacaatagt
tttgaagaattatcagatgttgatgcctctattacagatgacaatatgctaacaacactg
ccaggaggactttacgtacttggaactatggttatgctacttgtggctgaaattctggaa
aagaaatag

DBGET integrated database retrieval system