KEGG   Tribolium castaneum (red flour beetle): 657761
Entry
657761            CDS       T01046                                 
Name
(RefSeq) acyl-CoA synthetase short-chain family member 3, mitochondrial
  KO
K01908  propionyl-CoA synthetase [EC:6.2.1.17]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca00640  Propanoate metabolism
tca01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    657761
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:tca01004]
    657761
Enzymes [BR:tca01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.17  propionate---CoA ligase
     657761
Lipid biosynthesis proteins [BR:tca01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   657761
SSDB
Motif
Pfam: AMP-binding ACAS_N AMP-binding_C
Other DBs
NCBI-GeneID: 657761
NCBI-ProteinID: XP_969296
BEETLEBASE: TC001434
Position
LGX:complement(3954399..3958489)
AA seq 683 aa
MLNPKEQNTMCESRVNEVSTIVRNIKYDRHVYDSENVIEKENPYYSKKYEEAYKKSITNP
EEFWPEVGKLVTWTKPWDKVMDHSHPPFTKWFAGGELNACYNAVDRHVEAGRGSKVALIH
DSPLTKTVRKITYAELLDQVSHLAGALAKLGVSKGDRVLIYMPLIPEAVIAMLATARLGG
VHSVVFGGFAARELCARIVHAEPKVIIAASCGIEPHKIVRYKDILNDAIEWSSHKPNKCI
IFQRRNVECAPIDVEMDILWEDALKMAGPHECIPVEANDPLYILYTSGTTDQPKGIQRPV
GGHIATLTWSMSVIYGMGPNDVWWAASDLGWVVGHSYICYAPLLYGITSVMYEGKPDRTP
DPGQYFRIINEHKVNAIFTVPTAFRVIHREDPDIEFGRKYSIRSLRTIFVAGEHCDYETK
MWAEKTFNVPVLNHWWQTETGHAITATCLGYGHNLSPPKYTAGMPFPGYDIKILRSDGME
ASNNELGRIVIKLPLPPGTMSTLYQAPERFCQVYFSRYPGYYDTMDAGYKDEYGYIYVTA
RDDDVINVAGHRISTSALEDVVLAHPDIADATVVGVPEHTKGEVPLCLYVIKRNAKKSEV
AISRDLLRMVRELVGPIAAFRMAVAVRGLPRTRSGKTCRKSISDLARNKEVRISGTVEDP
TVYKDIKAALQKLGFAHTAPDPQ
NT seq 2052 nt   +upstreamnt  +downstreamnt
atgttaaatccgaaagaacagaatacgatgtgtgaatcaagagtcaacgaagttagcacc
attgtgaggaatatcaaatacgaccggcacgtgtacgactccgaaaacgtaatcgagaag
gaaaacccttactatagcaaaaagtacgaagaggcctacaagaagtccatcaccaacccc
gaggagttctggcccgaggtgggcaagctggtcacatggaccaagccctgggacaaggtg
atggaccactcccatcccccgttcaccaaatggttcgcagggggcgaactcaacgcctgc
tacaacgccgtggaccggcacgtggaggcgggccggggctccaaggtggccctcatccac
gacagccccctgaccaaaaccgtgcggaaaatcacctacgccgagctgctcgaccaagtc
tcgcatctggcgggcgcgctggccaagctgggggtgtccaagggggaccgcgtgctcatt
tacatgccgctcatccccgaagcggtcatcgcgatgctggcgacggcacggctcggggga
gtgcactcggtggttttcggaggttttgcggcgagagagctttgcgctcggattgtgcac
gcggagcccaaagtgataatcgctgcgagttgtgggatagaaccgcataaaatcgtacga
tataaggatatcctgaacgatgcaattgagtggtcgtcccacaagcccaacaagtgtatt
atcttccaaagacggaacgtggagtgtgcccccatagacgtcgaaatggatattctgtgg
gaggatgcgctgaaaatggccggacctcacgagtgcatcccggttgaggccaacgatccg
ctctatattctctatacgtctggaaccacagaccagccgaagggcatccagaggccggtc
ggcggccacatcgcaaccctcacttggagtatgagcgtgatctacggaatgggcccgaac
gacgtttggtgggcggccagcgatctgggctgggttgttggtcattcgtacatttgttac
gcgccgcttttgtatggaataacaagcgtaatgtacgagggaaaacccgaccggacgcca
gacccaggccaatactttaggataattaacgagcacaaagttaatgcaatctttactgtt
cctactgctttccgggtgatacatcgcgaggaccccgatattgagttcgggcgaaaatat
tcgattaggagtttacggacgattttcgtggctggggagcactgcgactatgaaacgaaa
atgtgggccgaaaagacgttcaatgtgcccgttttgaaccactggtggcagacggagact
gggcatgccatcactgccacatgtctggggtatgggcataatctgagtccgccgaagtac
acggcagggatgccttttccgggatacgatattaagattttgcggtcggacggcatggaa
gcgtcaaataacgaattgggccgaattgtgataaagctgccgctgccgccggggaccatg
tccacgttgtaccaagcgcccgaacggttttgccaagtctatttcagccgatacccaggc
tattatgacaccatggacgcggggtacaaggacgagtacggttacatttatgtgacggcc
cgtgacgacgatgtgattaatgtcgctgggcacagaatatccacttcggcgttggaggac
gtggttttggcccacccagacattgccgacgcgacggtggtcggagttccggagcatacg
aaaggggaggttccgctctgtttatatgtcataaagagaaatgccaaaaagagtgaagtc
gcaataagtcgcgatttattaaggatggttagggaattggtcggaccaatcgcagcgttt
cgcatggcggtggcagtgcgaggtttgccgcgaactcgctcgggtaaaacgtgcaggaaa
tctatatcggatttagcccgaaataaggaagttaggatttcgggcactgtagaagatcca
acagtttacaaagatattaaggctgctctccaaaaactggggttcgcacatactgcgccg
gatccccagtga

DBGET integrated database retrieval system