KEGG   Tribolium castaneum (red flour beetle): 657852
Entry
657852            CDS       T01046                                 
Name
(RefSeq) prosaposin
  KO
K12382  saposin
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca00600  Sphingolipid metabolism
tca04142  Lysosome
Brite
KEGG Orthology (KO) [BR:tca00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    657852
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    657852
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tca04147]
    657852
Exosome [BR:tca04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   657852
SSDB
Motif
Pfam: SapB_1 SapB_2 SapA Lact-deh-memb
Other DBs
NCBI-GeneID: 657852
NCBI-ProteinID: XP_966852
UniProt: D6WA77
Position
LG2:complement(11135363..11139949)
AA seq 842 aa
MKILILVSLVAFFAFTSGVFVPPRPGHKRLVDSKECTWGPSYWCQNLTAASDCRAVRHCI
QTVWVHKQLPPDGSSICQTCLDMVKQARDQLESNETQELIKEVFEGSCHLLHFKEIVKEC
DKIADQYIPELIDTLASEMNPQVVCSVAGLCNSEKVQKLIAEEKGLKPQNVGTCEGCQTV
VGIMEEKFNKMSRDDVLQSFLQICGRTGSLSDGCSNIVITYFNEIYNHLKDNFNPTDFCL
MTGECSSKFHTHANVEITPMSHIGYVQVGGKQKDDLPCEFCEQLVTHLRDLLIANTTEHE
FKRVLEGLCKQTKSFKAQCLSLVDEYYGAIYTFLVSELNANEVCVFAGICPRNNTQGVPP
IMPLLPVETLEITPAPVIRVNIAKDGSSVKVMARPEEIQLPIERMMPPHAQEMYNSQTCV
FCEYFLHYLQQAITTPATEEEIKEVIDKACAKLPRSINTTCVEFVDTYEPALVAILAQEI
DPSQVCPLIKACPSNTRDVEVFMQQGSDGSKCPLCLFAVSKLEQMVKDKKTEQNIKAALN
KLCDHLPNDIAAECNDFVNTYTDELVQLLIADLTPQEVCVYLKLCSDNKPPTGFIGGDTS
TNMIADDTINGKNVKLAPVTDNPRCVLCEFIMKEVQDELKDNSTEEAIKKTVHNICNIMP
KSISKECNDFVNEYADTIIQLLIEATVPSEICRMMHMCDNTQIEQAKVEIFECAICESLV
YAMEKILDNPKVDHSIDHVLEKACRALPHKEQTKCTEIIEKYGKTIYNLVTHLADKGLVC
KEIALCAARPARPSRPTLVGANRCTWGPSFWCASDENAEKCGKAAKVHCQQKIWLAPSAP
KV
NT seq 2529 nt   +upstreamnt  +downstreamnt
atgaagatattaatcctcgtatcgcttgtggcattttttgccttcacaagcggagttttc
gtccctccccgaccaggacataagcgtttggtagattcaaaagaatgcacttggggacct
tcatactggtgccagaatttaacggcggcttccgactgccgcgctgtgagacactgcatc
caaacggtttgggtgcacaagcagttgcccccagatggtagtagcatttgtcagacttgt
ctcgatatggttaaacaagcacgagaccaacttgaaagtaacgagacccaagagttgatc
aaagaagtgtttgaagggtcatgccatctcttgcactttaaagaaatcgttaaagagtgc
gacaaaatcgctgatcagtacatccccgaattgattgatactttagcttcggaaatgaac
ccacaagtcgtgtgttccgtggctggtttatgtaacagtgaaaaggtccagaaattgata
gctgaggaaaaaggtttgaagccacaaaatgtgggcacttgtgaaggttgccagactgtt
gttgggataatggaggagaagtttaataaaatgtcacgcgacgatgtgttgcaaagcttc
ttacagatttgtgggcgaactggcagtttgtcagatgggtgcagcaacattgttatcaca
tacttcaacgaaatttacaaccatttgaaagacaatttcaatccgactgatttttgtttg
atgactggagagtgtagctcaaagtttcacactcatgctaatgtcgaaatcacgccaatg
tcgcacattgggtacgtgcaagttggagggaaacaaaaggacgatctcccgtgtgaattt
tgcgagcagttggttactcatttgcgagacttgctcattgctaatacgaccgaacatgag
tttaagagagtccttgaagggttgtgcaagcaaacgaaatcattcaaagcacaatgcctt
agtctagtcgatgagtattacggcgctatttatacattcttggtttcggaattgaacgct
aacgaagtgtgtgtttttgccggcatttgtccaagaaacaatacgcaaggggtgcctcca
attatgcctcttttaccagtcgagactttggaaatcaccccagcgccggtaatccgagtc
aatatagccaaagatggctcgtcggtcaaagttatggcacgacctgaggaaatacaacta
ccaattgagcggatgatgccacctcacgcccaggaaatgtacaattcccaaacttgcgtc
ttctgcgagtatttcttgcattacttacaacaagctatcaccactcctgcaacagaggag
gaaataaaggaagtaattgataaagcctgcgctaaattaccccgcagcatcaacaccaca
tgtgttgagttcgttgatacttacgagccagctttggtggcaattttggcgcaagagatc
gacccctcgcaagtttgtcccctgattaaagcttgcccgtccaacacgagagacgtggaa
gtgttcatgcaacaaggctctgacggttccaagtgtcccttgtgtctgtttgccgtttca
aagcttgagcaaatggtgaaagacaaaaaaactgagcaaaacatcaaggcagcactcaac
aagttgtgcgatcatttgccgaatgatatcgccgctgaatgtaacgattttgtcaacact
tacactgatgagctcgtccagttgcttattgctgatttaaccccgcaagaagtttgcgtc
tatcttaaactttgttcggataataaaccaccgactggttttatcggcggtgatacttcc
acgaatatgatagctgatgacacaattaatggaaaaaatgttaaacttgcaccagtcacc
gataatccaagatgcgtcctttgcgagttcataatgaaagaagtgcaagacgagcttaaa
gacaattctactgaagaagccatcaaaaaaacagtgcacaatatttgtaacatcatgccc
aagtcaattagcaaagaatgcaacgattttgtaaatgaatacgccgataccattatccaa
ttactgattgaagcaacggtccctagcgaaatctgccgcatgatgcacatgtgcgataac
actcaaattgaacaagcaaaggttgaaatttttgaatgtgccatttgcgaaagtctggtt
tatgccatggagaagattttggacaacccgaaagttgatcacagcattgaccacgtcctg
gagaaagcgtgccgggctttaccccacaaagagcaaacaaagtgcacggaaatcatcgaa
aaatatggcaaaaccatctataatctcgtgacacatttggccgacaagggactagtctgt
aaagaaatcgctctctgtgctgctagacccgcccgaccgagtcgtccaaccttagtgggg
gcaaatagatgcacatgggggcccagcttttggtgtgctagtgacgaaaatgccgagaaa
tgtggcaaagcggctaaggtacattgccaacaaaagatctggttggcaccgtcggccccc
aaggtgtga

DBGET integrated database retrieval system