KEGG   Tribolium castaneum (red flour beetle): 657863
Entry
657863            CDS       T01046                                 

Name
(RefSeq) PH and SEC7 domain-containing protein 1
  KO
K12494  PH and SEC7 domain-containing protein
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:tca00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    657863
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tca04131]
    657863
Membrane trafficking [BR:tca04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    657863
SSDB
Motif
Pfam: PH_9 Sec7 PDZ PDZ_6 PH PDZ_2 Peptidase_M50 DUF6288 DUF695
Other DBs
NCBI-GeneID: 657863
NCBI-ProteinID: XP_008198766
Position
LG10
AA seq 984 aa
MSEELLVVLNRSENSGFGFSLLGKPGLPPIIYNILDDSPAAESGEVEVGDVILKVNETDV
NRFSTKEVLKCLRLSSDPVTLKIKRDPKIKATVRKHLLSVGGDSAAPRPRPRPGPLVHQS
HVRNGSCPPEQQSLLSDPDDNDRLQWEPLAASDKKPSNKPKFEAYMMTGEHILNISRMPK
QQKKIESLRYHNSHTHHLRHQQQHNSVPNSPNEMDMGSKGNHCKSGSNSANTSPVSANKW
DTHPSPGSGDGSKYNSNFVRTSRSEDQLQASQNDNCGMSAVNIDVDDDITSSLNTLLDTR
PESVSASGDSDRIVWTYNAPPTGDHHAKFCHTLSNGSSSSHSNTSPSSSPLHSGSPASPT
SVSSSVMSSQSGSRRLPYTPTGGVAPPPPTNGDFSVSEAISNISSPDYHDDDSMGIRDCV
MEISDHSDSDSTLLVSEPRQRQNSDHRIVIQVKGPDNRGKTCDSQNEMVELADLDDDGAR
NPSPQSSEDESDVESLHSFHYSPKAVDLPSAIRLAKRLYSLDGFKKSDVSRHLSKNNDFS
RAVAEEYLKYFNFENDTLDIALRKFLKQFSLTGETQERERVLVHFSKRYLDCNPGSFNSQ
DAVHTLTCAIMLLNTDLHGQNISRKMTCNEFIENLAGLNEQENFPRDVLKALYHAIKNYP
LEWALDEDTEDGAAQMPKPGEQIGANPFLDVPMSSNAVEYKKGYVMRKCCYEANAKRSLC
CIFLAPFHKRSWKMFYCTLRDLVLYLHKDENGFRKNQMGDNFHNAIRIHHALATKATDYT
KKMFVFRLQTADQAEYLFQTGDSKELQSWIDTINFVAASFSAAPLEAAVGSQKKFQRPLL
PCSHTKLNMREQLRDHEERVLRLESELEDHRKSPPDKGSKSLIVQNYKEKESYLTFEVKR
YRTYSYILRSRIGQYVEPHPVSLVENSIGEVDEAAAAGGPMDVTGGVVVPPPIPDRPAPS
TNRCSFSVHITYFPRIFDARRGPE
NT seq 2955 nt   +upstreamnt  +downstreamnt
atgtcggaggaactgttggtcgttctgaatcgtagtgaaaactccggtttcggtttttcc
ctgttgggaaaaccaggcctaccacccatcatctacaacattttggacgattctccggcc
gctgaaagcggagaggtggaagttggagacgttatcttgaaagttaacgaaactgacgtg
aatcgtttcagtacgaaagaagttttaaaatgcctacgattatcgtcagatcctgtaaca
ctaaaaataaaacgtgatccgaaaatcaaagcgactgttcgtaagcacctcctctctgtt
ggcggcgactctgccgccccccgtccccgcccccggcccggccccttggttcaccagagc
catgtccgcaatggcagctgcccccctgaacaacagtccctcctctctgaccccgacgac
aacgaccgcctccagtgggagcctttggcagctagcgacaaaaagccgagcaacaaaccc
aaatttgaggcttacatgatgaccggcgagcatatcctcaacatctcgcgtatgcctaaa
caacagaaaaagatcgagagtttgaggtaccacaacagccacacccatcacctccgccac
cagcagcaacacaattcggtgccaaacagtcccaacgaaatggacatgggctcgaagggc
aaccattgcaaatcgggctcgaattcggccaacacttcgccggtcagtgccaataaatgg
gacacacacccatcaccaggctctggtgatgggtccaagtataatagcaattttgtgagg
acgagtcgttccgaagaccagttacaagcatcacaaaatgataattgtggaatgagtgct
gtgaatattgacgttgatgatgacatcaccagctcgctgaatacgcttctggacacccga
cccgagtcagtgagcgcttcgggtgacagcgacagaatcgtgtggacgtacaacgccccg
cccaccggcgaccaccacgccaaattctgccacaccctctccaatggcagcagttcgtcc
catagtaacacctccccctcgtccagtccccttcattccggctcgccggcgtctcccaca
tcggtgtcttcctcggtgatgtccagccaatccggttcgcgtcgacttccatacacaccc
actggaggcgtggctccgccacctccaaccaatggcgattttagcgtatcggaggcaatt
tcgaatatttcaagtccggattatcatgatgatgacagtatgggcatcagagattgtgtg
atggagattagtgatcatagtgacagtgacagtacgcttttggtgtcggaaccaagacaa
cggcagaatagtgatcatagaatagtgatacaagtgaaaggaccggataatagaggcaaa
acctgtgatagtcagaacgaaatggtcgaactggccgaccttgatgatgacggtgctcga
aacccttcgccacagtcgtcggaagacgaaagcgacgtcgaaagtctgcacagttttcat
tattcgccaaaagcggtcgatttgccttcggccattcgtttggccaaacgtctctacagt
ctagatggctttaaaaaatcggacgtttcacgacatctcagtaaaaataacgatttcagc
cgcgctgttgccgaagaatacctaaaatatttcaatttcgaaaacgacactctagatata
gccctacgaaagttcctcaaacagttctctctcaccggcgaaacgcaggaacgcgagaga
gttttggttcatttttctaagagatatttagactgcaatccgggttcttttaattcacaa
gatgcggtacatacgttgacgtgcgccattatgctgctcaataccgatctacacggccag
aatattagcaggaaaatgacctgtaatgaatttatcgaaaatttagctggattaaacgaa
caggaaaactttccgagggatgttcttaaggcgctctaccacgccatcaagaattatccg
ctggagtgggcgctagacgaagatactgaagatggcgccgctcaaatgccgaaacctggc
gaacaaatcggcgctaatccgtttttggacgttccaatgtcatcgaacgccgtcgaatac
aagaagggttacgtcatgcgcaagtgctgttacgaggcgaacgccaaacgaagcctttgc
tgcatttttctagcaccgtttcacaagcgtagctggaagatgttttattgtacattgcgg
gatttggtgttgtatctgcacaaggacgaaaacggcttcaggaagaatcaaatgggtgat
aattttcataatgcgataaggatacaccatgcactagccaccaaagctacagattatacg
aaaaaaatgttcgtttttaggttacagaccgccgatcaagccgaatatttatttcagact
ggtgattcgaaagaactgcaatcatggatcgatacaattaattttgtggctgctagtttt
tcggcagctccgctagaggccgctgttgggtcgcagaaaaaattccaaaggccactcttg
ccctgtagtcatacgaaattaaatatgcgtgagcagcttcgcgaccacgaggagagagta
cttagactggaatcggaacttgaagatcaccgtaaatcgccccctgacaaaggctccaag
tcactaatagtccaaaactacaaagaaaaagaatcctatttgacatttgaggtgaagcga
tatcgcacctattcgtacattctgcggtcgcggattggccaatacgtggagccacaccct
gtcagtttagtcgagaatagcattggcgaggtggacgaggcggccgcagccggtggacca
atggacgtgactgggggcgtggtcgtcccgcccccgatcccagacaggcccgccccctcc
accaataggtgtagtttttctgtgcacataacttacttcccccgaattttcgacgcaagg
agaggccccgagtga

DBGET integrated database retrieval system