KEGG   Tribolium castaneum (red flour beetle): 657929
Entry
657929            CDS       T01046                                 

Definition
(RefSeq) xylosyltransferase oxt
  KO
K00771  protein xylosyltransferase [EC:2.4.2.26]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca00532  Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate
tca00534  Glycosaminoglycan biosynthesis - heparan sulfate / heparin
tca01100  Metabolic pathways
Module
tca_M00057  Glycosaminoglycan biosynthesis, linkage tetrasaccharide
Brite
KEGG Orthology (KO) [BR:tca00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00532 Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate
    657929
   00534 Glycosaminoglycan biosynthesis - heparan sulfate / heparin
    657929
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:tca01003]
    657929
Enzymes [BR:tca01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.26  protein xylosyltransferase
     657929
Glycosyltransferases [BR:tca01003]
 O-Glycan biosynthesis
  Glycosaminoglycan
   657929
SSDB
Motif
Pfam: Branch Xylo_C WSC
Other DBs
NCBI-GeneID: 657929
NCBI-ProteinID: XP_015840452
BEETLEBASE: TC002371
UniProt: D7EJH3
Position
Un
AA seq 873 aa
MVVSKGGNGRWLRKYKTFFLIGLIILLFQVLLAAHFLELKANSSDDWQPQSHKAVTQGLE
NHRKKLQVANTTALRLEELNFRPECEITGKEAVSAIHRAKSQNCKQLIANVTCKSLAGTL
YPKRLTGSCPNGGKIAGKALGCFKDENNYRLLSGYFGVNKKSNSPEYCIQLCLQSGFEYA
GVQYSHECFCGNDEPLSTFKLPDSSCNMKCPGDPHATCGGYYTINVFQTGIKKFVPQVAN
TESPPSHENVKIVFLLTLNGRALRQVKRLLKILYHTRHFYYIHVDVREDYLFRELLPLER
RFPNIRLTRRRFATIWGGASLLEMLLSCMSELLDTPWTWDFVLNLSESDYPVKQISALER
FLGANRDRNFVKSHGRDTQRFLQKQGLDKTFVECDRRMWRVADRRLPEGIQMDGGSDWIA
LSREFVSYVAKSGDDLVGGLRQVFRHTLLPAESFFHTVLRNSRFCDSYVDNNLHVTNWKR
KLGCKCQYKHVVDWCGCSPNDFRPDDWARIQSTQPRQLFFARKFEPIINQAVLLKLELWL
FGLDKPSRSVTNLHSYWQSVYHHLDLSPAIDDGLRTVTSSVGRVWSKTVTNATCSVTILR
ATSFHTKDLYKYTLVHFTTSDSADIEVAFRPINMTYLVAPSTLTKRIEELAVSSDYDQKE
QISRNFPRILSPYSEPVLVYKFAASGASVTHNITCLWLDPIGQLVEISDISIEESALIGH
SKPNLKHPHRPGSWTVKLIYHQTLLAEVKFLITPLEFYSGVPLGVKQARLIHGGSVSRPL
TDNYDRFIENSDEGILKGVSVSNSNKTGKELQDWIDSLFSKFYVIEKSCAVGRTEVCGVQ
VEECRRTSWSSFAPDPKSFIGSVNETSGAFDIW
NT seq 2622 nt   +upstreamnt  +downstreamnt
atggttgtgtccaagggcggtaacggaagatggctcagaaagtacaaaacgttttttctc
atcggtttaataatcctgctcttccaagtgctcctggctgcgcattttctcgagttaaag
gcaaactcatcagacgattggcagccacaaagccacaaagcggtgacacaaggactagaa
aatcaccgaaaaaaattacaagtcgcaaacaccacagctttgcgcttggaagagctaaac
ttcagacctgaatgtgaaatcactggaaaggaagcagtttcggcaatacatcgtgccaag
agccagaattgtaaacaactgatcgcaaatgtgacttgtaagtctttggcggggactttg
taccccaaacgactgaccggaagttgtcccaatggcgggaaaatcgccggaaaggccttg
ggttgcttcaaggatgaaaataattacagactgctcagtggctactttggggtcaataaa
aagagcaattcgccggagtattgcatacagttgtgtctccaatccgggtttgagtacgcc
ggggtccaatattcacatgagtgtttttgtggcaatgatgagcccctttcaacgttcaaa
ctacccgattcgtcgtgtaatatgaagtgtcccggggacccccatgctacctgtggaggc
tattacaccattaacgtgtttcagacgggaataaaaaagttcgtccctcaagttgccaac
actgagtcgcccccaagccacgaaaacgtcaaaatcgtattcctgctcaccctcaacggc
cgagccctccgccaagtgaaaagactgctcaaaatcctctatcacactcgccacttctac
tacatccacgttgacgtgcgagaagactaccttttccgcgaactcctccccctggagcgc
cgcttccccaacatccgcctcactcgccggcgcttcgccaccatctggggcggcgcctcc
ctcctggagatgctcctgagctgcatgtccgagctcctggacacgccctggacctgggac
ttcgtcctcaacctcagcgagtccgactaccccgtcaagcaaatctccgcgctggagcgc
ttcctgggggcgaaccgcgaccgcaacttcgtcaagtcccacggcagggacacccagcgc
ttcttgcagaagcaaggcctggacaagaccttcgtcgaatgcgaccggcgcatgtggcgc
gtggcggaccgccgtctcccggaaggcatccaaatggacggtgggagcgactggatcgcc
ctctcgcgggagtttgtgagttacgtggcgaaaagcggtgatgatctagtcggcgggctt
aggcaggtttttagacatacgttattgccggccgagtcgttttttcatacagttttgcgt
aattcgcgtttttgcgacagttatgtcgataataatcttcacgtgaccaattggaagcgg
aagctgggttgtaaatgtcagtataagcacgttgttgattggtgcgggtgtagtccgaac
gatttcaggcccgatgattgggccaggatccaaagtacgcaaccgcgtcagttatttttc
gcgcgcaagtttgaaccaatcatcaatcaggccgttctgttgaaactcgaactgtggctg
ttcggattggataaaccgtcaaggtcagtcacgaacttgcattcctattggcagagcgtc
taccaccatttggacctatcaccggccattgatgacggtttaagaactgttacttcgtca
gttggccgtgtgtggtccaaaaccgtaactaacgccacctgtagtgttacaattttacgt
gcaacatcattccacaccaaagacttgtacaaatatactttggtccactttacaacaagt
gattcggccgatattgaagttgctttccgaccgatcaacatgacatatctcgtagcgccc
tctacactcaccaaacgtatcgaagaactagccgtcagcagtgactacgaccagaaagaa
caaatttcgcggaacttcccccgaatattatcaccctactccgaaccagtcctagtttac
aaattcgccgcgagtggcgccagtgtcacccacaacatcacgtgtctttggctcgacccc
attggccagctcgtcgaaatcagcgacatatcaatcgaggaaagcgctctgattggccac
tccaagcccaatctgaaacacccccaccggcccggctcatggaccgttaaactaatctac
caccaaactcttctagctgaagttaaattcctaataaccccgcttgaattttactcgggg
gttcctctgggtgtgaaacaagcccgcttgattcatggcggttctgtttcaaggccactt
accgataactacgataggtttatcgaaaatagtgacgagggtattttgaaaggtgtgagt
gtgtctaattccaacaaaacaggaaaggaattgcaggattggatcgattcgctgtttagt
aagttttacgtgattgagaaaagttgtgcggttggtaggactgaggtttgtggggtgcaa
gtcgaggagtgcaggagaacgagttggagttcttttgcgcccgatccgaagagttttatt
gggagtgttaatgagacgagtggcgcgtttgatatctggtaa

DBGET integrated database retrieval system