KEGG   Tribolium castaneum (red flour beetle): 658064
Entry
658064            CDS       T01046                                 
Name
(RefSeq) putative protein kinase C delta type homolog
  KO
K06068  novel protein kinase C delta type [EC:2.7.11.13]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:tca00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    658064
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tca01001]
    658064
Enzymes [BR:tca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     658064
Protein kinases [BR:tca01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   658064
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C
Other DBs
NCBI-GeneID: 658064
NCBI-ProteinID: XP_008197709
Position
LG9:complement(5723445..5748729)
AA seq 1620 aa
MPYYSELGIYMSPTSSYTGSYIPGPYSNHSSLLASNFTRPPPSLLKPRNFRGYKPLLATI
TENQSPLRRYNSPKLRGHTSPKVIVAKPIKINTADIDVSVNKYRKYERPKPVQDKVERKS
PSPSDTLDSPRSSEKEAKPNKTIRRDRPTVRLHTVHCDMIAPDNGANTRSWRDNFEPEEL
KTEEKKPKKTPGELLKEKFLIRSREDIFKAPEKKVSRRASKKTNVQKTPSFHDICQAITT
DQIDEELNPGQPIEIQRRQSRQFASENLLKDLRRNSGDLTNEVELLNRRNAELSDTRGSV
KRRKKLTKKKSNEKVVLTEPDGNKSQLQRRPTQKKIRRTSTSSSVGSDIVDVSPETEKAY
QEAIRDISQVEIENIKIKPKPIITATVDVEEKPALKVVVDEIEVVESPKPKKGNKFKFNV
IVEEIDTKRTSMKKPQTKVEEKVHVPKAKEPLVSNILRKNSNAHLGNILEEAVNKSEAEV
KKSDSAEEMKKVVVVKTISKKEDKEPVQIRKTDSDDKVVVSKEVAQERANQDQTSGQQLK
QSSSVPDMEMKKNEVGKPKEDEKSTSAKKVEAPLKKELSLDKVKKEDEKSTAAKKAESQL
KKDSSIEKITSGNVVKLKEHEESTTVKKIEPELKKNLSLEKINDKVERPKEDEKSTAMKK
VEPQLKKNLSLEKINIDKVEKPKEDKPTVVKKVEPQLKKNSSLEKINNDKVEIPKEDEKS
MAVKKVEPQLKKDLSVEKINNNKVEIPKEDEKSTAVKKVEPQLKKNSSHEKINIDKVEKP
KEDEKSTAVKKVETQLKKDLSVEKINNNKVDKPKEDEKSTAVKKVESQLKKNSSLEKINN
DKVEKSKEDEKSTAVKKVETLLKKDSSLEKVKINKVEKPKEDEKSTVVKKVEPQLKKNSS
LEKINNNKVDKPKEDEKSSIQLKKDLSVEKSDKVEVKSSSIVGKTSSKKEKSDDELGQQS
KIPSKLDNKQPTSQDAAKAPESPKTLKPSLKKTVGEPLKKSTSVKIIEETKKSPAPDELK
KSSSAQKIEETKENEEENFWAAIGPRESVYTSARKPLSPPQKPEEKDDELIPAKAMPSKR
SLVNKANKDDPDLEVFIPPPEPEPEPEPEPELEPAFVPLQSNRLSQFMHPFKKPEQFDEC
PVEIYATPKVIRHRHYPRPRHPPPPVEKSESEEEEEDEESEEETTSSEETSSSDDEYDVN
VVYGNNKVGASTSSNDSGFDSGVPGSRNKGSTETRDSPTSNPANNPALALDSNEVLEEYS
HSSTFASFQKSGRITPPATTIPRFRKYGVEDFNFLKVLGKGSFGKVLLAELKNTEYYYAI
KCLKKDVVLEDDDVECTLIERKVLALATKHPYLCHLLCTFQTESHLFFVMEYLNGGDLMF
HIQKSGRFPEAQARFYGAEIVSGLKFLHNKGIVYRDLKLDNILLDFDGHVRIADFGMCKL
QIFLDRMADTFCGTPDYMAPEIIKGQHYNQCVDWWSFGVLLYEMLLGQSPFSGCDEDELF
WSICNEKPVIPRFLSQEASAVLQLFLEKDGNKRLGNRFCPAGDIQDQPFFKPIQWDKLEA
RLLEPPFKPNLQHPLDTQYFDKTFTAEKAKLTPIEQNILQSMDQTQFQGFSYTNPNATDK
NT seq 4863 nt   +upstreamnt  +downstreamnt
atgccgtactattcggaacttggaatatatatgagtcctactagtagttacacgggctca
tatatacccggtccttattccaatcattcctctttgctggcctcaaatttcacgaggccg
cctccttccctgctcaagccgcgcaattttcgcgggtacaagcccctgctcgcgaccatc
accgagaaccagtcgcccttaaggcggtacaattcgcccaagttgcgagggcacacctcg
cccaaagttatagtggccaagcccatcaaaataaacacagctgatatcgacgtttccgtg
aacaagtacaggaagtatgagcggcctaagcccgtacaagacaaagttgagaggaaatcg
ccaagtcccagcgacactctagacagtccacggagctcagagaaggaagcaaagcccaac
aaaaccatccgaagggacaggccaacggttcgcctccacaccgtccactgtgacatgata
gcacccgacaacggtgcaaacaccaggagttggagggacaacttcgagccagaagaactg
aaaaccgaggagaagaagcccaaaaagacacccggtgagctcctcaaggagaagtttttg
attcgcagtcgggaggacatcttcaaagcgcccgagaagaaggtgagtagacgggcgtcg
aagaaaacaaacgtgcaaaaaacgccgagctttcacgacatctgccaagccataaccacc
gaccaaatcgacgaagagctaaaccctggccagcccatcgaaatacaaagacgccaaagt
cggcaatttgcaagcgaaaacctcctcaaagacctaagacgcaactccggcgatttgacc
aacgaagttgagcttctgaaccggcgaaacgccgagctttctgacacgcgtggaagcgtc
aagcggcggaagaaactgaccaagaagaagtccaacgagaaagtggtcctcaccgaacct
gacggcaacaaatcgcagcttcagcgaagaccaactcagaagaaaatccgccggacttcc
accagcagcagcgtggggagcgacattgtcgatgttagtcctgagactgagaaggcgtac
caagaggcgattcgtgacatttcccaggttgagattgaaaatatcaaaattaagcctaag
cctattattactgcaacggttgatgtggaagagaaaccagccttgaaggtggttgtggac
gagattgaagtggtggagtcgccgaagccgaaaaagggtaacaagtttaagtttaacgtg
attgttgaggagattgacacgaaacggacatcgatgaagaagcctcaaaccaaagttgag
gaaaaggtgcacgtgccgaaggccaaggaacctttggtgtcgaatattttgaggaagaac
agcaatgcgcaccttggcaacattttggaagaagctgttaacaagagtgaagccgaagtg
aagaaaagtgacagtgcggaagaaatgaagaaagttgtagtggtaaagacaatttcgaag
aaagaagataaggaacctgttcagatcagaaaaactgacagtgatgataaagttgtggtg
tctaaagaagttgcacaggaaagagcaaatcaagatcaaacttctggtcaacaattgaaa
caatcttctagtgttccagatatggaaatgaagaaaaacgaagtaggaaaaccaaaagaa
gatgaaaaatcaacatctgcaaagaaagtggaagctccgttaaagaaagaattgagtctc
gacaaagtgaaaaaggaagatgaaaaatcaacggctgcgaagaaagctgaatctcaactg
aagaaagattcgagtatcgagaagattacaagcggcaatgtagtaaaacttaaagaacat
gaggaatcaacgactgtgaagaagattgaacctgaattgaagaaaaatctgagtcttgaa
aagataaacgacaaagtagaaagaccaaaagaagatgaaaaatcaacggctatgaagaaa
gttgaacctcaattgaagaaaaatttgagtcttgaaaagataaacatcgacaaagttgaa
aaacctaaagaagataaaccaacggttgtgaagaaagttgaacctcaattgaagaaaaat
tcgagtcttgaaaagataaacaatgacaaagtagagataccaaaagaagatgaaaaatca
atggctgtgaagaaagttgaacctcaattgaagaaagatttgagtgttgaaaagataaac
aacaacaaagtagagataccaaaagaagatgaaaaatcaacggctgtgaagaaagttgaa
cctcaattgaagaaaaattcgagtcatgaaaagataaacatcgacaaagtagaaaaacca
aaagaagatgaaaaatcaacggctgtgaagaaagttgaaacccagttgaagaaagatttg
agtgttgaaaagataaacaacaataaagtagacaaaccaaaagaagatgaaaaatcaacg
gctgtgaagaaagttgaatctcaattgaagaaaaattcgagtcttgaaaagataaacaac
gacaaagtagaaaaatcgaaagaagatgaaaaatcaacggctgtgaagaaagttgaaacc
ctattgaagaaagattcgagtcttgaaaaggtaaaaattaacaaagttgaaaaaccaaaa
gaagacgaaaaatcaaccgttgtgaagaaagttgaacctcaattgaagaaaaattcgagt
cttgagaagataaacaacaacaaagtagacaaaccaaaagaagatgaaaaatcatcaatc
cagttgaagaaagatttaagtgttgaaaaaagtgacaaagttgaagtcaaaagtagttct
atcgttggtaaaaccagttcaaagaaagaaaaatcagatgatgagttaggtcagcagagc
aaaattccctcaaagcttgataataaacaaccaacaagtcaagatgccgccaaagcccca
gaaagtcccaaaacacttaaaccaagcttgaagaaaacagtaggagagccactgaaaaaa
tcaaccagcgttaaaattattgaagaaacgaagaaaagtccagctccagacgaactgaaa
aaatcaagcagtgcccaaaaaatcgaagaaacgaaggagaatgaagaagaaaacttctgg
gctgcgattggaccccgcgaaagcgtctacacttcagcccggaaaccgttaagtccaccc
caaaaaccggaagaaaaggacgacgagttaatcccagccaaggcaatgccgtcaaagcgt
tcattggtcaacaaggctaataaagatgacccggatttggaggtgtttatcccgcccccg
gagcccgagccggagccggaacccgaacccgagctggaacccgccttcgtccctctccag
tccaaccgtttgtcccaatttatgcacccgtttaaaaaacccgaacaattcgatgaatgt
cctgttgaaatttacgcgactccgaaagtaatccgccatagacattatccgcgaccgcga
catccgccgcccccggtcgaaaagtccgagagcgaagaagaagaagaagacgaagaaagt
gaagaagaaacaacgtcgagtgaagagacgtcgtcatctgacgatgaatatgacgtcaat
gtggtgtatggcaataacaaagttggtgcaagtacgtcttccaatgactctggctttgat
tcgggcgtccctggcagtagaaataagggatcaaccgaaacccgggactccccgacttcc
aaccccgcaaacaaccctgccctagctctagactcaaacgaagtcttggaagagtattcc
cactccagcacttttgccagcttccagaaaagtggcagaataacaccaccagctacgaca
attccacgatttagaaaatacggtgtcgaagacttcaatttcctcaaggttctgggcaaa
ggaagcttcggaaaggttctcttggcagagctgaaaaacaccgaatattattatgccata
aagtgcctgaaaaaagacgtcgttttggaagacgacgacgttgagtgcaccctaattgaa
agaaaagtcctggctttggcaacgaaacatccatatttatgccatttattatgcaccttc
caaaccgagtcacatttattcttcgtgatggagtatctaaacggcggcgacctcatgttt
cacatccaaaagtcgggccgatttcccgaagcccaggcccgcttctacggcgctgaaatc
gtttcaggcctgaaatttctccacaacaaaggcattgtttacagggacttaaaactcgac
aatattttgttggactttgacggtcatgtgaggatagcagattttggcatgtgcaagctt
cagatatttttggaccgaatggccgatacgttttgtggcactcctgattatatggcacct
gaaataattaaaggacaacactacaaccagtgtgttgattggtggtcattcggtgtactt
ttgtacgaaatgttgctaggtcagtcacctttcagtggctgtgacgaagacgaattattc
tggtccatttgtaacgagaaaccagtgattccccggtttttgtcacaagaagcgagcgct
gttctacaactgtttttggaaaaagacggaaacaaacgattaggaaataggttttgccca
gctggtgatatccaagaccagccgtttttcaagcccatccagtgggacaaactcgaggcc
aggcttttagaacctccctttaaacccaatttgcaacacccgttagatacgcagtacttt
gacaaaactttcacggccgaaaaagccaaattgaccccaatcgaacaaaacattttgcaa
tcgatggatcagacccagtttcaaggtttcagttacaccaaccccaacgctacggacaag
tga

DBGET integrated database retrieval system