KEGG   Tribolium castaneum (red flour beetle): 658182
Entry
658182            CDS       T01046                                 

Definition
(RefSeq) cell division cycle 5-like protein
  KO
K12860  pre-mRNA-splicing factor CDC5/CEF1
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:tca00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    658182
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:tca03041]
    658182
   03400 DNA repair and recombination proteins [BR:tca03400]
    658182
Spliceosome [BR:tca03041]
 Complex B
  Other components
   Prp19 complex
    658182
 Complex C
   Prp19-CDC5 complex
    658182
DNA repair and recombination proteins [BR:tca03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   PSO4 complex
    658182
SSDB
Motif
Pfam: Myb_Cef Myb_DNA-binding Myb_DNA-bind_6 DUF1664 Rap1_C
Other DBs
NCBI-GeneID: 658182
NCBI-ProteinID: XP_969684
BEETLEBASE: TC011382
UniProt: D6X4C5
Position
LG10
AA seq 798 aa
MPRIMIKGGVWRNTEDEILKAAVMKYGKNQWSRIASLLHRKSAKQCKARWFEWLDPSIKK
TEWSREEDEKLLHLAKLMPTQWRTIAPIIGRTAAQCLERYEYLLDQAQKKEEGEDVTDDP
RKLKPGEIDPNPETKPARPDPKDMDEDELEMLSEARARLANTQGKKAKRKAREKQLEEAR
RLAALQKRRELRAAGIEVNSRRKKKRGVDYNEEIPFEKRPAIGFYDTSTEIVDPMAPDFH
KMRQQHLDGELRSEQEERERRKDKQKLKQRKENDIPQAMLQNQEPAKKRSKLVLPEPQIS
DLELQQVVKLGKASEVAREVAAESGIESTDTLFNDYTVAAPQAAAVTPRTPAPQTDRILQ
EAQNVMALTHVDTPLKGGRNTPLHNSDFSGVLPQALTIATPNTVLATPFGAQTPGFMTPQ
GPQGSFTPSVRDKLNINEENTEMVAQTPAEQRSLQNNLKEQLRLGLSSLPTPKNDYEIVV
PEQEEEEKEEEKTPNIVEDQADVDARALEEAKIRAAQELALRSQVIQRGLPRPHDVNLAV
LRPNHESHSLTELQKAEELIKCEMVTMLQFDNLKNPNQVKRSALAQAQQLAFLEQHPYDD
FKSDDLKLAKQLLKREMEIVKYGMGHGELPLEAYTQVWEECLGQVLFVPNLNKYTRANLV
SKKERLESAEKRLEQNRSHMAREAKKAAKMEKKLKILTGGYQSRAQALIKQLADYYDQID
QANLELNTFKFLQEQEKAALPRRIQSLTEDVNRQMEREKGLQGRYGELQGQIKELQSELE
KLQQEIEVARGEQEGEAE
NT seq 2397 nt   +upstreamnt  +downstreamnt
atgccgcgtataatgataaaggggggcgtttggcgcaacaccgaggatgagatcctcaaa
gcggcggtaatgaaatatgggaaaaaccagtggtctcgaattgcctcgctccttcaccgc
aaatcggccaaacagtgtaaagcgcgttggttcgaatggttggaccccagtattaaaaaa
acggaatggtcgcgggaagaggacgaaaagttgctacatttggccaagttaatgccgact
cagtggcgcacgatagcccccataatcgggcgaacggccgctcagtgtttggagcgctac
gagtacctcctggatcaggcacagaagaaggaagaaggggaggatgtcacggacgacccc
cggaagctcaaaccgggggaaattgaccccaatccggaaaccaagcctgcgaggcccgac
cccaaagacatggacgaggatgagctggagatgttgtccgaggcgcgcgccaggcttgcc
aacacccagggcaaaaaagcgaagcgaaaagcgcgcgaaaagcagctggaagaagcgcgt
cgattggcagcactgcaaaaaaggcgcgagcttcgagctgccggcatcgaagtgaattcg
cgtcgtaagaaaaaacgcggtgttgactacaatgaggaaatccccttcgaaaaacgtcca
gcgattggtttttacgacacttccaccgaaattgttgatccaatggcgcccgattttcac
aaaatgcgtcaacaacatctcgacggtgaactgcgaagcgaacaagaagaacgcgaacgt
cgcaaagataaacaaaaattaaaacaaagaaaagaaaatgatattccacaagcgatgcta
cagaatcaagaaccggcgaaaaaacgctcgaaattggtacttcccgagccgcaaattagc
gatctggagttgcaacaagtcgtaaagttgggtaaagcgagtgaagttgcacgtgaagtt
gcagcagagagtggaatcgagtcgactgatacgttgttcaatgattatacggtggcggcg
ccacaagcggcagcggtgactccccgaactccggcaccgcaaactgatcggatacttcaa
gaagcgcaaaatgtcatggctttgacgcatgtggataccccactcaaagggggccgaaac
acgccacttcacaactcggatttttcgggcgttttaccacaagccctcaccatagccact
cccaatacggtcctggcgacccctttcggggcccaaacccccggtttcatgacaccgcag
ggcccccaaggcagttttacgccttcagttcgtgacaaactcaatataaatgaggaaaac
accgaaatggtggcacaaactccagccgaacagcgttcgctccaaaacaatttaaaagaa
caactaagactaggcttaagtagtttaccgacaccgaagaacgactacgaaatcgtcgtt
cccgaacaggaagaagaggaaaaagaagaagaaaaaacgccaaatattgtcgaagatcag
gcagatgttgatgcgcgagcgcttgaagaagcgaaaattcgggcggctcaggagttagcc
ctgcggtcgcaggtgattcaaagggggctgccgcgcccccacgatgtaaatttggccgtt
ttgcggccgaatcacgagtcgcattcgttgaccgagctgcagaaagccgaggaattgatc
aagtgtgagatggtgacaatgttgcaatttgacaatttgaaaaaccctaaccaagtcaag
cgctcggctttggctcaggcccagcagttggcattcctggaacagcacccgtatgacgat
ttcaaatcggatgatttaaaacttgccaaacaattattgaaacgtgaaatggaaattgta
aagtatggaatgggccatggggaattacctttggaggcatacacccaagtttgggaggag
tgtctgggacaagtgctttttgttccaaatttaaacaaatacacgagggctaatctagtg
tcgaaaaaagagcggttagaatcggcggaaaaaagactggaacagaaccgctcacatatg
gcgcgcgaggcgaaaaaggcggcaaaaatggagaaaaaactaaagattttgacagggggt
tatcaatcgagggcgcaagcccttatcaaacaattggccgattattacgatcagatcgat
caagcgaatttggagttgaatacgttcaagtttttgcaagagcaggagaaggcggcgctc
ccgaggcgcatacagtcgttaaccgaggatgttaaccggcaaatggagcgggagaaaggg
ttgcaaggacgttacggcgagttgcagggacaaatcaaggagttgcaaagcgagttggag
aagttgcaacaggagattgaagttgcaaggggggagcaggagggggaggctgagtga

DBGET integrated database retrieval system