KEGG   Tribolium castaneum (red flour beetle): 658195
Entry
658195            CDS       T01046                                 
Name
(RefSeq) 60S ribosomal protein L14
  KO
K02875  large subunit ribosomal protein L14e
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca03010  Ribosome
Brite
KEGG Orthology (KO) [BR:tca00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    658195
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:tca03011]
    658195
Ribosome [BR:tca03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    658195
  Archaea
    658195
SSDB
Motif
Pfam: Ribosomal_L14e KOW DDE_1
Other DBs
NCBI-GeneID: 658195
NCBI-ProteinID: XP_969696
UniProt: D6WI33
Position
LG3:complement(29934438..29935612)
AA seq 167 aa
MPFKRFVETGRVALVADGPNKGKLVSIVDVIDQTRVLVDGPASKVPRGQLRLNQLHLTKF
RLKFPFTASTRIVRKAWTDAKIDEQWADSAWAKKVAAKKKRAQLTDFDRFKLRRARSRRN
HIRTITFRNLKKAASRNGTLYGKKKMAKGGDKPKPKKGAQVKKGKSK
NT seq 504 nt   +upstreamnt  +downstreamnt
atgcctttcaaaaggtttgtggagaccgggcgcgtggccttggtggccgacggccccaac
aagggcaaattggtcagcattgttgatgttattgaccaaacgagggtgttggttgatggg
cctgctagtaaggtaccccgtggccaactccgcttgaatcagctacatttgaccaaattt
aggctgaaattcccgttcacagcttcgactcgtatcgtgcgcaaagcgtggacagatgct
aaaatcgacgaacagtgggcggactcagcatgggctaaaaaagtagccgccaagaaaaag
agggcccaattgactgatttcgatcgtttcaaattgcgccgcgcgaggtcccgcaggaat
cacatcaggactattacgttccgaaacttgaagaaagccgcttcaagaaacggcactttg
tacggcaagaagaagatggcgaagggtggagataagcccaagccgaaaaaaggggcccaa
gttaaaaagggcaagagtaaataa

DBGET integrated database retrieval system