KEGG   Tribolium castaneum (red flour beetle): 658224
Entry
658224            CDS       T01046                                 
Name
(RefSeq) U6 snRNA-associated Sm-like protein LSm7
  KO
K12626  U6 snRNA-associated Sm-like protein LSm7
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca03018  RNA degradation
tca03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:tca00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    658224
  09123 Folding, sorting and degradation
   03018 RNA degradation
    658224
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:tca03019]
    658224
   03041 Spliceosome [BR:tca03041]
    658224
Messenger RNA biogenesis [BR:tca03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     658224
  mRNA degradation factors
   5'-3' decay
    Lsm complex
     658224
Spliceosome [BR:tca03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   LSm proteins
    658224
SSDB
Motif
Pfam: LSM
Other DBs
NCBI-GeneID: 658224
NCBI-ProteinID: XP_969723
UniProt: D6WYZ2
Position
LG8:13573017..13573571
AA seq 113 aa
MASSGDKSKNQSGDQKEKKRKESILDLSKYLEKTIRVKFAGGREASGILKGYDPLLNLVL
DNTIEYLRDPDDPYKLTEDTRALGLVVCRGTSVVLICPMDGMESIQNPFISQD
NT seq 342 nt   +upstreamnt  +downstreamnt
atggcatcgtcaggtgacaaatcaaaaaatcagagcggtgaccaaaaagagaagaaacgt
aaagagtcgattctagacctctctaaataccttgaaaagacaattagggtgaaatttgcg
ggcggccgagaagctagtggtattttaaaaggctatgacccccttttgaacctcgtctta
gacaacacaatcgaatacttgagagatccagacgacccttataaattaacagaagacacg
agggccttgggtttggtggtctgtaggggcacaagtgtcgtgctcatatgccccatggac
ggcatggagtccatacagaacccctttatatcccaagactaa

DBGET integrated database retrieval system