KEGG   Tribolium castaneum (red flour beetle): 658445
Entry
658445            CDS       T01046                                 

Gene name
Mu, Pph13
Definition
(RefSeq) munster
  KO
K09452  homeobox protein aristaless-related
Organism
tca  Tribolium castaneum (red flour beetle)
Brite
KEGG Orthology (KO) [BR:tca00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:tca03000]
    658445 (Mu)
Transcription factors [BR:tca03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, Prd
    658445 (Mu)
SSDB
Motif
Pfam: Homeodomain
Other DBs
NCBI-GeneID: 658445
NCBI-ProteinID: XP_969925
BEETLEBASE: TC006110
Position
LG8
AA seq 277 aa
MLVEHFPCLYYDRSRKTHEKLSIENTPPVVSLHPFVIRDLVVEKRWKSPSYLKNALAMEE
KASPGPSYAINTFLNNLDFEKEDRQDYHNYAEDDANNASKRKQRRYRTTFSNYQLEELER
AFHKTHYPDVFFREELALRIDLTEARVQVWFQNRRAKWRKQEKSVKNAQNINIPSACSTP
LESPLLNFPPEQSPTNLFLGLEWPSIVPQVPYQSVDNINETVLIGDRIAGIHTNLIGDGI
LLGEEGNLDLIQNDPEIGIDPDLLTLKPARHNRSEDC
NT seq 834 nt   +upstreamnt  +downstreamnt
atgcttgttgaacattttccgtgtctgtattatgaccgaagccgtaaaacgcatgaaaag
ctttcaatagaaaatacgccaccagtcgtaagtcttcatccgttcgtaatacgcgatttg
gtggtggaaaagcgttggaaaagcccgtcatacctgaaaaatgccctagctatggaagag
aaagccagtcccggcccttcgtacgccatcaacaccttcctcaacaacttggattttgag
aaagaagaccgacaagattatcacaattacgccgaagatgacgccaataacgcctcgaaa
cgcaaacagcggcgctatcgaaccaccttttccaactatcaattggaagagttggaacgc
gcgttccacaaaacccattatccggacgtcttcttccgcgaagaactggccttgaggatc
gacctaaccgaagccagggtccaggtttggttccagaaccggagggccaagtggagaaag
caggaaaaaagcgtcaagaacgcccaaaatatcaacatcccttcagcctgttctacgcct
ctggagagccccctgttgaatttcccccccgagcaaagccccactaacttgttcctgggc
ctggagtggccctcgatagtcccccaagtcccgtatcaaagtgttgataatatcaacgaa
accgttttaataggcgaccgaatcgcgggcattcacaccaatttaataggggacgggatt
ttgttgggggaggaagggaatctggatttgatccagaatgatccagaaatcgggatcgat
ccagacttgctgaccttgaagccggccaggcataacaggagcgaggactgttga

DBGET integrated database retrieval system