KEGG   Tribolium castaneum (red flour beetle): 658484
Entry
658484            CDS       T01046                                 

Name
(RefSeq) syntaxin-18
  KO
K08492  syntaxin 18
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca04130  SNARE interactions in vesicular transport
tca04145  Phagosome
Brite
KEGG Orthology (KO) [BR:tca00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    658484
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    658484
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tca04131]
    658484
Membrane trafficking [BR:tca04131]
 SNARE
  Syntaxin (Qa)
   Stx-rER
    658484
SSDB
Motif
Pfam: Syntaxin-18_N SNARE Med21 Syntaxin_2
Other DBs
NCBI-GeneID: 658484
NCBI-ProteinID: XP_008198938
UniProt: D6X505
Position
LG10:6802627..6803762
AA seq 294 aa
MDITILFKACVKTVRTTNKALGLQESKPALPKSGPKDPNLATAKEVVKQITHFQTFLLEN
KAAYLNVLNYLSTNKTMTEVDREQIDTTAEKIVTTCTSLISDYKKEICKLPKSKQKEEHY
HNVIDSLERYLKTVSKIYTEAKAIRVKRVLETHKVAKLETIGSKGSLEPPIVPPVSPPPV
DIEDQLSVEEMQMFESENEMLYNELNSTSEEVKQMESKVVHIAELQELFTEKVLQQEQDI
ERIANNVVGATSNMRDANEQIRQAIQRNAGLRVWVLFFLLVMSFSLLFLDWYND
NT seq 885 nt   +upstreamnt  +downstreamnt
atggacataacaatacttttcaaggcttgtgttaagactgtgaggacgactaacaaggcc
ttaggcctgcaagagtccaaaccggcgctcccgaagtcgggtccgaaggaccccaatttg
gcgactgctaaagaagtggtgaagcaaataacgcacttccaaaccttcctcttagagaat
aaagcagcgtacttgaacgtactaaactatttatccaccaataaaaccatgacggaggtt
gaccgagagcaaatagacacaacagctgagaaaatcgtaaccacatgtacttccctcatt
agcgactataaaaaagaaatttgcaagctgcccaaaagcaagcaaaaggaggaacactac
cacaacgtgatcgactcactcgagcgctacttaaagacagttagcaaaatatacaccgag
gcgaaggcaattcgcgtgaaacgtgtcttggagacgcacaaagtggccaaattggagaca
attggcagtaaagggagtttggaacccccgattgtacccccagtatcgccccctcccgtc
gatatcgaagaccagctatcagttgaagaaatgcaaatgtttgagtcggaaaacgaaatg
ctctacaatgagctcaactcaacgtccgaggaagtcaaacaaatggaaagcaaagtcgtg
cacattgccgaacttcaggaattattcacggagaaggtcttgcaacaggaacaggatata
gaaaggattgcaaacaacgtcgtgggggctacgagtaacatgcgggacgctaatgagcaa
atcagacaagcgattcaaaggaatgcaggcttgagggtctgggtgctgttttttctgcta
gttatgtcgttttcgctgctgtttctcgactggtataacgattaa

DBGET integrated database retrieval system