KEGG   Tribolium castaneum (red flour beetle): 658519Help
Entry
658519            CDS       T01046                                 

Definition
(RefSeq) ribonuclease P protein subunit p20
  KO
K14527  ribonuclease P/MRP protein subunit RPP20 [EC:3.1.26.5]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca03008  Ribosome biogenesis in eukaryotes
tca03013  RNA transport
Brite
KEGG Orthology (KO) [BR:tca00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    658519
   03008 Ribosome biogenesis in eukaryotes
    658519
Enzymes [BR:tca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.5  ribonuclease P
     658519
Ribosome biogenesis [BR:tca03009]
 Eukaryotic Type
  Pre-60S particles
   RNases
    RNase MRP
     658519
Transfer RNA biogenesis [BR:tca03016]
 Eukaryotic Type
  5'processing factors
   Ribonucrease P
    658519
Mitochondrial biogenesis [BR:tca03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   RNase MRP
    658519
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rpp20 Alba
Motif
Other DBs
NCBI-GeneID: 658519
NCBI-ProteinID: XP_969995
UniProt: D6WVU2
Position
LG8
AA seq 131 aa AA seqDB search
MEGPSGAPPRKPKPHSDHILRKRQSQKPQFGKTVIYVNTKTPVKALLDRCSKLISEGEKE
ITIYCLGAAIQRGTLLALKVCEENVGFQIHTNTFTTELIDDLEPATDDADYAIQRRFNSA
LKIKVSKPDLL
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atggaaggaccctcaggtgccccaccgcgtaaaccgaagccccactccgatcacattttg
cgcaaaagacagtcgcagaagcctcaatttggaaagaccgtaatttacgtcaatacaaag
actccagtcaaggcacttcttgaccgttgttccaaactaatcagtgagggggagaaggaa
attacgatttattgcctgggggctgccatacagaggggcaccttgttggctttgaaagtg
tgtgaggagaatgtagggtttcagatacacactaatactttcacaacggaattaatcgat
gatttagagccggccactgacgatgctgattacgccatccagcgcaggtttaactcagcg
ttaaaaatcaaagtttccaagccagatttgctgtga

DBGET integrated database retrieval system