KEGG   Tribolium castaneum (red flour beetle): 658565
Entry
658565            CDS       T01046                                 

Name
(RefSeq) arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1
Organism
tca  Tribolium castaneum (red flour beetle)
SSDB
Motif
Pfam: RhoGAP PH Mcp5_PH
Other DBs
NCBI-GeneID: 658565
NCBI-ProteinID: XP_970036
UniProt: D6WE41
Position
LG3:complement(69041..75519)
AA seq 1082 aa
MSHPVPAPRSNAPDVKKPVPTPRKSTKLKPEPPEEHTNTFSRRVRSLSNASRQIAEDIGE
LVQDKKKAMIAGTRQSVRRITKRFNSYHSESPQDPEPAEDDFGDTLDIFNSISFQSPLSS
TSAIYNNVEAEEFNAPPPTHPPPPLPQECIYDAPASISGGSTSNSEQSNLGNYPPNYESV
FPVYSNSDSDLSRSGSWRFYDPVNKVENIYNDLDVTVQRTECDVNSNVSEFSTEVRNSLY
ENHTIAARVQAEKKCRESVIMQFDPLRTGSTVGEDVCFPQSVLPSEDIKMLEEYFQGDLY
GNVSITRTLDEWSISNDSEPEEFITPPMPPVRIDSLPEEEQSPREKSRSQWFTSSDSVKE
NKEEPKKFGWLKQIKGALEKAPEVVKGVRNKDTVVQRPELEIKSFVHKKGMLYKVQSGPV
EDLFGEYSGRWCILQNSNFICYSDSTCDTVKEHFPAESILSVQILQDPKFKYKYDNDDLH
CFELNTTGKSRGGHIYGTRDISERRVWMQSIAESLTKKFPVKITTDYTRMGWAYLREGVG
GRWVGAWLMLSHRTLYYAVDNQPTKTMDLRKVRCMVLQVYQENDNNPRTNDKGPNIVVDT
PGVTLYLRMWTSRETKVWCHIVKLAAHNNGAHLDQQQLTKNDIPVLVEKCINFIYTHGSM
TEGIYRRPGTNTAVAEILAKFRKDAWAVQLTIDKYTEHDVATALKRFIRDIPEPVLTNSQ
RQYLHQVSLVKNKDERIRMYKAALDQLPPISYKTAKKLLGHLHFIASQSKKNLMNVDNLA
AVWGPSLMHQEEKDNNSVGNTKHVQNTVVVRQLLELYRDIFPEDPAEIEKEKVMLQVLEK
HTKALQGAANNAKKAGDFRVWIYLHNKEGQPMNVAIGPNKTAYEVCVELSPKINMPVHEL
VLEEVVLNDRLQRPVHFSEKVLDIVLRWSYWEESDRKDNHLVLLPIAKYSDFIHDKSTPV
SAELKFSDNRSRNFKLYTFEFSQAKLNCFKDKTCEEKLFTYNIEDIMWYLGHESKKNPQS
RWTITFIETKMHPQRTKNCPYFGNVLVWGDPQTRAKWLGAMLKARYRESLIQPAMHINLM
VN
NT seq 3249 nt   +upstreamnt  +downstreamnt
atgagccatccggtaccagcccccaggtccaatgcgcccgatgtcaaaaagccagtcccc
acaccacgcaaaagcacaaaactaaaacctgaaccccctgaagagcacaccaacaccttc
tccagaagggttcgctctttgagcaatgcttcacgacaaatcgccgaagatatcggcgaa
ttggtccaggataagaagaaagctatgattgcgggaactagacaaagtgttcggagaatc
accaagcgttttaattcgtaccactcagagtccccacaggaccctgagcccgctgaagat
gattttggcgataccctcgatattttcaactcgatcagtttccaatcgccgctcagttca
acttccgccatttacaataatgtggaggcggaggagttcaatgcgccgcctccgacacat
ccaccgcctccattgccccaggagtgcatctacgatgccccagcttccatttctgggggc
agtacaagcaattccgaacagtcaaatctagggaattatccaccgaactatgaaagtgtt
tttcccgtttattcaaacagtgattcggatttatccagatccggttcgtggagattctac
gatccggtcaataaagtcgaaaatatttacaatgatttggatgtgacagttcaaaggact
gaatgcgatgttaattcgaatgtgagcgaattttccacggaagtacgaaattcgttgtac
gaaaatcatacaatagcggcaagagtacaagcagagaagaaatgtcgagagagtgttata
atgcagtttgatccgttgaggactggtagcactgttggtgaagatgtgtgtttcccccaa
tccgttcttccatccgaagacatcaaaatgctcgaggaatattttcaaggcgatctttat
ggcaatgtttccatcacgcgaactttggatgaatggagcatttcaaatgattcggaaccg
gaagaatttatcacacctccaatgcctccagttcgtatcgattctctcccagaagaagaa
caatcacctcgagaaaaatcgcgaagtcaatggtttactagttccgattctgttaaagaa
aataaggaagaaccgaaaaaattcggatggttgaaacagatcaagggggcacttgaaaaa
gctcccgaagtggtcaaaggtgtgagaaataaagatacagtggtccagagacccgaatta
gaaattaaaagttttgtacacaagaaaggaatgttgtataaggtgcaaagtggacctgtt
gaagatttgttcggggagtacagtggaagatggtgcattttacagaattcaaattttatt
tgctactcggatagcacttgtgatacagtcaaggagcattttccggccgagagcattcta
agtgtgcaaattttgcaagatcctaaatttaaatacaaatacgacaacgacgaccttcac
tgtttcgaactaaacacgacgggaaaaagtcgcggaggtcacatctatggaacacgcgac
atttctgaacgacgcgtttggatgcaatccattgccgaaagtctaacaaagaaattccct
gtgaaaatcactaccgattacacacgtatgggctgggcataccttcgggaaggtgttggt
ggacgatgggtgggcgcttggcttatgctatcccacaggactttgtactatgccgttgat
aatcaaccgactaaaacgatggatttgagaaaagtacgatgtatggtattacaagtatac
caagagaatgataacaatccaaggactaatgataaagggccgaatattgtggtggataca
cctggtgtaacgctttatttacgcatgtggacgtctagggaaacaaaggtttggtgccat
attgttaagctggcagcacacaacaatggtgctcatttggatcagcaacagttgacgaaa
aatgatattccagttttagtggaaaagtgcatcaattttatttacactcacggaagcatg
actgagggaatttacagacgtccaggcactaacactgcagttgcagaaattttggcgaaa
ttccgtaaagacgcttgggcagtacaattaacaattgataaatatacagaacatgatgtt
gcgactgctttaaagcgattcatcagagacatacctgaaccagttctcacaaacagccaa
cggcaatatttacatcaagtttcattggtgaagaataaagacgaaaggataagaatgtac
aaagcagctctcgatcagctcccgcctatttcatacaaaacggcgaaaaaactcctcgga
catctccactttattgcgtcacaaagcaaaaaaaatctgatgaatgtcgataatttggct
gcagtttggggaccgagtttaatgcatcaagaagaaaaggataataattcggttggaaac
accaaacacgttcaaaacactgtagttgtacgacagttgttggaattatatagggatatt
tttccagaggatcccgccgaaattgaaaaggaaaaagtcatgttacaagtgttggaaaag
cacactaaggcactacaaggtgcagctaataatgcaaaaaaagctggcgattttcgggtg
tggatttatttgcataataaggaaggacagccaatgaatgttgcaattggcccaaataag
actgcgtatgaagtttgcgtggagctaagtccgaaaatcaatatgccggtacacgaattg
gttttggaggaagttgttttgaacgatagattacaacgacctgtgcatttttccgaaaag
gttttggatatcgtccttcggtggagttattgggaggaatccgatcgaaaagacaatcat
ttagtccttcttcctatagcaaaatattccgactttattcacgacaaatcgacaccagtt
tcagcagaactcaaattttccgataacagatcaaggaatttcaagttgtacacgtttgaa
ttttcccaagccaagcttaactgttttaaggataaaacgtgtgaggagaaactcttcact
tacaacattgaagacatcatgtggtatttaggtcacgaatctaaaaaaaatccacaatcg
cggtggacaatcacatttatcgaaactaaaatgcatccacaacgtactaaaaactgtcct
tatttcggtaatgtgttggtttggggtgatccacaaaccagagccaaatggttgggtgca
atgttgaaagcgagatatagggagagtttgatacagccagctatgcatatcaatttaatg
gttaattga

DBGET integrated database retrieval system