KEGG   Tribolium castaneum (red flour beetle): 658569
Entry
658569            CDS       T01046                                 

Name
(RefSeq) peroxisomal biogenesis factor 3
  KO
K13336  peroxin-3
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:tca00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    658569
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tca04131]
    658569
Membrane trafficking [BR:tca04131]
 Autophagy
  Pexophagy
   Selective cargos
    658569
SSDB
Motif
Pfam: Peroxin-3 BST2
Other DBs
NCBI-GeneID: 658569
NCBI-ProteinID: XP_970039
UniProt: D6WI62
Position
LG3:complement(8621435..8622859)
AA seq 344 aa
MSVFSKVRNFFSRHRNKFIVGGVIIGGSIFLTRYAQQKLREWQEKEALEFLDRNRKHQHF
ESIGRTCNQTILNLALALNETISKNINTEEVIERLKTNPENKLALWNELKVLVFNKAACT
IYANVMLVVTLKIQLSIIGGYLYKDPTSLSSEMQERYLSLCQNLMDAGFSRLSRLVETNC
RKVLEPVNLTKQLKLSDLEALFWSIQTAVATHNDNPVENLRQYVLPELPVSDGIYEKMVK
ETAELLNSDEVKALVTHCTTRGFMVLAEQLSEFYTSNGVKENGKLPEGDEFTNPFNVKKP
MAKVLPIMNGLFSKKSLPDQFLQQLIVYEKLQLLSANVYESFLS
NT seq 1035 nt   +upstreamnt  +downstreamnt
atgtccgtgttttccaaagtgaggaatttcttcagccgtcaccgtaataaattcatcgtt
gggggcgtcataatcgggggctctatcttcctaacgcgttacgcgcagcagaaattgaga
gaatggcaagaaaaagaagcgctagaattcctggacaggaacaggaagcaccaacatttc
gaaagcatagggcggacgtgcaaccaaacgattttaaacctagccctggctttgaacgaa
acaatttccaaaaatatcaacactgaagaagtcatagagcgactgaaaaccaacccagaa
aacaaactagctctctggaacgaactgaaagtcctagtgttcaacaaagccgcgtgtacc
atctacgcaaatgttatgttggtggtcactttaaagattcagttgagcataattgggggc
tatttgtacaaggaccccacgtccctctcttcagaaatgcaggagaggtacttgtctctt
tgccaaaacttgatggatgcagggtttagtaggttaagcagattagtagaaacaaattgt
aggaaggtgctagagcctgttaatttgacaaaacagttgaaattgagcgacttggaggct
ctcttttggtcgatccagacggccgtcgcgacgcataatgacaacccagttgagaatttg
cgacaatatgttctacctgagctgccagtctctgacggaatttacgaaaaaatggtaaaa
gagaccgccgaacttctcaacagtgatgaagttaaggccctagtgacccactgtactact
agggggttcatggtgttggcggaacaattatccgaattttacacaagtaatggagtgaaa
gaaaatggaaaactgccagaaggtgacgagtttacgaatcctttcaatgtgaaaaaacca
atggcgaaagttttaccaataatgaacggacttttttccaaaaagtcactacccgatcag
tttttgcagcaattaattgtgtatgaaaaactgcaattattgagcgcaaacgtttacgaa
tcgtttttgtcgtaa

DBGET integrated database retrieval system