KEGG   Tribolium castaneum (red flour beetle): 658610
Entry
658610            CDS       T01046                                 

Gene name
Lyz, TC010350, TC010351, TC010352
Definition
(RefSeq) lysozyme
  KO
K13915  lysozyme C [EC:3.2.1.17]
Organism
tca  Tribolium castaneum (red flour beetle)
Brite
KEGG Orthology (KO) [BR:tca00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tca04147]
    658610 (Lyz)
Enzymes [BR:tca01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     658610 (Lyz)
Exosome [BR:tca04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   658610 (Lyz)
SSDB
Motif
Pfam: Lys SLT Transglycosylas SLT_3 Phage_lysozyme2
Other DBs
NCBI-GeneID: 658610
NCBI-ProteinID: NP_001159495
BEETLEBASE: TC010349
Position
LG3
AA seq 590 aa
MAELFVLFLVAITFVECKVYDRCELARELKHVHKFPGHQIATWVCIAKHESTFNTSAVNR
GSGDHGLFQISDLFWCSPPGNGYACNAPCSAFEDDDITDDIACVRRIFKEHSVLSGNGFN
AWAVYPLYCKQDASKYIEGCFDNEIDSNISGTTTTTSPDVDDVKAKIFERCELAKELKKN
HLPGTQLATWMCIAKYESHYNTAAINTQTGDHGLFQISQIYWCSNSNKPGKGCNAKCSEF
RDNDIRDDVACVKKIYKEHQRLSGNGFNAWVAYKKYCTGNNDHFIKGYKNLRVNISKSKM
NPLSKLLVLLFVSLCVSLQIEAKVFKRCELAKELKNKHHIPGNQLATWMCIANYESGFNT
AAINKKTGDHGLFQISQIYWCSNSNKPGKACNAKCSDFRNNDIKDDVACVKKIYNEHQKL
SGNGFNAWVAYKKYCRGNNNNNLSTVAKMKLLAVVAIFAFASLSEAKIFDKCEFANTIRG
YGLFPAEHISTWVCIANYESAFNTDATNTVTGDHGIYQISQIYWCSTGDSPGGGCNKRCA
DFHNDDISDDSVCAKAIFDEHQRLSGNGFNAWTTYAPYCSGDNSGWIAGC
NT seq 1773 nt   +upstreamnt  +downstreamnt
atggcagaactcttcgtgctttttctggtcgcaataacctttgtcgagtgtaaagtgtac
gatcgttgtgagttagcccgcgaattgaaacatgttcataaatttcccggccatcaaatc
gcgacctgggtttgcatcgccaaacacgaatcaaccttcaacacatcggctgtcaaccgt
ggtagtggagatcacggacttttccaaatcagcgacttgttctggtgctcaccacctggc
aatggctacgcctgtaatgccccctgttcggcctttgaggacgatgacataaccgatgac
attgcgtgtgttagaaggatttttaaagagcattcggttctgtcaggcaatgggtttaat
gcctgggctgtgtatcccttgtattgcaaacaagacgcatccaaatacattgagggatgc
tttgataacgaaattgatagcaatatcagtggaactaccacaacaacttcgcctgatgtt
gacgatgttaaagcaaaaattttcgaacgatgtgaacttgctaaagaattgaaaaagaac
catttgcctggaactcaactggcaacatggatgtgcatcgcaaaatatgaatcgcattac
aacactgctgctatcaacacgcaaacaggagaccatggcttgtttcaaataagccaaatt
tattggtgttcaaacagcaacaaaccagggaaagggtgcaatgccaaatgttccgaattt
cgagataacgacattcgggacgatgttgcctgtgtcaagaagatctacaaagaacatcaa
agactgtccggaaatgggttcaatgcctgggtggcttacaagaaatattgcacaggaaat
aatgatcatttcatcaaaggatacaaaaacttgcgtgttaacatcagtaagtccaagatg
aatcctttgagcaaattacttgtgctcctcttcgtttcgctttgtgtttcacttcaaata
gaagcaaaagtcttcaaacgatgtgaacttgccaaagaattgaaaaacaagcaccacatc
cctggaaatcaactggcaacatggatgtgcatcgcaaattacgaatcgggtttcaacact
gctgctatcaacaagaaaacaggagaccatggcttgtttcaaataagccaaatctactgg
tgttcaaacagcaacaaaccgggaaaagcatgcaatgcgaaatgttccgattttcgaaat
aacgacattaaagacgatgttgcctgtgtcaagaagatctacaacgaacatcaaaaactt
tctggaaatgggttcaatgcttgggtggcttacaagaaatactgcagaggaaataataac
aataacttgtctacagttgcaaaaatgaaacttctcgctgtggttgctattttcgccttt
gcttcgctgagcgaagcaaaaattttcgataagtgtgagtttgccaacactatcagaggc
tatggtctgttccctgcagagcatatttccacatgggtctgtatcgcaaattacgaatcc
gcttttaacaccgatgccaccaatactgtgactggagaccatgggatttatcaaataagt
caaatttactggtgttcgactggagatagtccaggaggtggttgcaataagagatgtgcc
gatttccataatgatgatattagtgacgattccgtgtgtgctaaagccatcttcgatgaa
catcagagactttccggaaatgggttcaatgcctggacaacttatgcgccttattgtagt
ggagataattctgggtggattgctggatgttag

DBGET integrated database retrieval system