KEGG   Tribolium castaneum (red flour beetle): 658650
Entry
658650            CDS       T01046                                 

Definition
(RefSeq) diphosphomevalonate decarboxylase
  KO
K01597  diphosphomevalonate decarboxylase [EC:4.1.1.33]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca00900  Terpenoid backbone biosynthesis
tca01100  Metabolic pathways
Module
tca_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:tca00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    658650
Enzymes [BR:tca01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.33  diphosphomevalonate decarboxylase
     658650
SSDB
Motif
Pfam: MDD_C GHMP_kinases_N
Other DBs
NCBI-GeneID: 658650
NCBI-ProteinID: XP_008190498
Position
LG3
AA seq 403 aa
MKTVTGIAPVNIAVVKYWGKRDEDLILPINDSLSCTLSTDFMCAKTTIMASPTFPTHRFW
LNGKESDFNNERLNNCLTESEYPFHAMQITSKNKTILVRKRANPKCGDLLNWKLHICSEN
NFPTAAGLASSAAGYAALVSTLSALYNVEGDISAIARRGSGSACRSIYGGFVRWNKGAKP
GGEDSIACQIASASHWPEMRVLILVVSDDQKKYSSTSGMKQSVLTSELLKHRAEKIVPGR
VDEIIKAIKLKNFEAFAKITMQDSNQFHAICLDTYPPCFYMNDVSRMIIELVHAYNDYQG
ATKVAYTFDAGPNACLYLLQNDVDEVASLINDIFPSNTNPSEFIRGLPVKLKNSNNLRET
LKIQTQTPNKLRYLIHTKIGEGPQILSEASEHLLGENGLPKNS
NT seq 1212 nt   +upstreamnt  +downstreamnt
atgaagactgttaccggaatagcacctgtaaatattgctgtcgtcaaatactggggcaaa
cgagacgaagacctaattctaccaataaacgactcattaagttgtaccctctcgacagat
tttatgtgcgctaagacaacaataatggccagccctacattcccaacgcatcgcttttgg
ctaaacggcaaagagtcagattttaacaacgaaaggttaaacaattgtttaaccgaaagt
gagtatccttttcacgcaatgcaaattacatccaaaaataaaacaattctagtacgtaaa
cgcgcaaatcctaaatgtggtgatttactcaactggaaacttcacatttgttccgaaaat
aattttcctacagccgctggtttggcctcatctgcagccggttatgcagctttggtttca
acactttcagctttgtacaatgttgagggcgacatttcagctatcgcacgcagaggctca
ggaagtgcttgtcgcagcatttacggcggatttgtcagatggaacaagggggctaaacca
gggggcgaagactcaatagcatgtcaaatcgcatcggcatcacattggccagaaatgcgc
gttttaatactggtggtcagtgacgaccaaaaaaaatacagctcaactagtggcatgaaa
cagagtgttctcacttccgagttattgaaacacagagctgagaaaattgttcctggtcga
gtggatgaaattattaaagcgatcaaattgaaaaattttgaagcttttgcaaaaattaca
atgcaagattcgaatcaatttcatgcgatttgtttagatacttatccgccttgtttttac
atgaatgatgtgtcaaggatgataattgagttggtgcatgcctataatgactatcaaggg
gccactaaagtcgcttatacgtttgatgcgggtcctaacgcctgtttatatttgttacaa
aatgatgttgatgaagtggcgtcgttaattaatgacatttttccaagtaatacaaacccg
agtgaatttattcgagggcttccagttaaattgaaaaattccaataatttaagagaaaca
ttaaaaatacaaacacaaacaccaaataaactcagatatttaattcatacaaaaatcggt
gaggggcctcaaattttgtcagaggcgtctgagcatttattgggcgaaaatggacttccc
aaaaattcataa

DBGET integrated database retrieval system