KEGG   Tribolium castaneum (red flour beetle): 658665
Entry
658665            CDS       T01046                                 
Symbol
CYP315A1
Name
(RefSeq) cytochrome P450 315a1, mitochondrial
  KO
K10722  ecdysteroid 2-hydroxylase [EC:1.14.-.-]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca00981  Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:tca00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    658665 (CYP315A1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:tca00199]
    658665 (CYP315A1)
Enzymes [BR:tca01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     658665 (CYP315A1)
Cytochrome P450 [BR:tca00199]
 Cytochrome P450, animal type
  CYP315 family
   658665 (CYP315A1)
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 658665
NCBI-ProteinID: XP_008193656
UniProt: D6WKZ9
Position
LG5:8277748..8279424
AA seq 465 aa
MLFRRVLAQLSTRPKSSLVSANTVLHFDEIPSPKGLPLVGTTLALIAHGSTPKLHDYVDK
RHKQLGPIFKEKLGPVSAVFVADPDEIRAVFDHEGKHPLHVLPDAWVAYNQMYGCPRGLF
FMDGANWWYHRRIMNRLLLKGDFRWIEGACECVSDKLIDSLMGESDYCGNLEATLYKWSL
DVIVSILLGSGSYSQLCGELEPKVQKLAQVTHLVFQTSAKLALIPASFASKFKIPQWRRF
VDSVDNALAQANALVDTLIEKKPHSDGLLPKLLAEQITLEDIKRIIVDLVLAAGDTTAVA
MEWMLYLVAKSPQIQEKLRRNPDFVKHVFKETLRLYPVAPFLTRILPEDAILGGYGVPKG
TLVVMSIYTSGRDGRYFKNPGLFQPERWDRKDEFYSSEMKKASLPFAMGLRACVGRKVAE
TQLQMTLLKIVNKFEVELGNQREVEIVLKMVAVPSEPLLLKFKKL
NT seq 1398 nt   +upstreamnt  +downstreamnt
atgctcttccgtcgtgttctcgcccaactctccacacgccccaagagttcgctcgtgagc
gccaacacagtcctccacttcgacgagatcccgtccccgaaggggctcccactcgtgggc
accaccctcgcgctcatcgcccacggctcgacccccaagctgcacgactacgtggacaag
cgccacaagcagctggggcccatcttcaaggagaaactaggcccagtgagtgcggttttt
gtcgcagacccggacgagatcagggcggtgttcgaccacgagggcaagcaccccctgcat
gtgctgcccgacgcctgggtggcctacaaccagatgtacggctgccccagagggctgttt
ttcatggatggggccaactggtggtaccacaggaggatcatgaatcggctgctcttgaaa
ggcgattttaggtggattgagggggcgtgcgagtgtgtcagtgataaacttatcgatagt
ttgatgggcgaaagtgactattgtgggaatttggaagccactttgtacaagtggtcgttg
gacgttatcgtctcgattttattaggcagtggtagttatagccaactttgtggggagttg
gaacctaaagtacaaaaactggcccaagtgacacacttggtgttccaaactagcgccaaa
ttggccttaattccggcctctttcgcgtccaaattcaaaataccgcagtggcggcgtttt
gtcgactccgtggacaatgccttggctcaagctaacgcgcttgtggacacgcttatcgag
aaaaagccgcacagtgacggcctcctccctaaactcctggccgaacaaatcaccctggag
gacatcaaacggattatcgtggacctcgtgttggcagccggtgacacgaccgctgtcgcg
atggaatggatgctctaccttgtggctaagagcccgcaaatccaggaaaagttgcgccga
aaccccgatttcgtcaaacacgtttttaaggagactttgcggctttaccccgttgcgccc
ttccttacaagaattctacctgaggatgccattttgggcggttatggggtgccgaaaggc
acccttgtcgtaatgtcgatttatacaagcgggcgtgacgggcgctatttcaaaaacccg
gggctttttcagccggaaaggtgggaccgcaaggatgagttctacagcagtgagatgaaa
aaagcgagtctgccgtttgcgatgggcttgagggcttgtgtcgggcgaaaagtggcagag
actcaattgcagatgacacttttgaagatcgttaataagtttgaagttgagctggggaac
cagagggaggtcgagattgttttaaagatggtggcggtgccctcagaaccgctcctacta
aagtttaagaaactgtga

DBGET integrated database retrieval system