KEGG   Tribolium castaneum (red flour beetle): 658676
Entry
658676            CDS       T01046                                 

Definition
(RefSeq) DNA-directed RNA polymerases I, II, and III subunit RPABC3
  KO
K03016  DNA-directed RNA polymerases I, II, and III subunit RPABC3
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:tca00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    658676
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:tca03021]
    658676
   03400 DNA repair and recombination proteins [BR:tca03400]
    658676
Transcription machinery [BR:tca03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol I, II, III common subunits
     658676
  RNA polymerase III system
   RNA polymerase III
     658676
  RNA polymerase I system
   RNA polymerase I
     658676
DNA repair and recombination proteins [BR:tca03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      658676
SSDB
Motif
Pfam: RNA_pol_Rpb8 RNA_pol_RpbG
Other DBs
NCBI-GeneID: 658676
NCBI-ProteinID: XP_015837491
Position
LG7
AA seq 134 aa
MCSIWFVSRLHCESESFKMDLILDINSWLYPMELGDKFRLVLATTLREDGYPDSGDWNPQ
GLETEGSRADSFEYVMSGKVYRIEGDEAAVEPSSRLAAYVSFGGLLMRLQGDANNLHSFE
VDQHMYLLMKKIFM
NT seq 405 nt   +upstreamnt  +downstreamnt
atgtgcagcatttggttcgtgagccgcttgcactgcgagagcgaatccttcaagatggac
ttgatcctggacataaactcctggttatatcccatggagttaggtgacaaattccgattg
gttttggcaacaactctgcgagaggatggttatcccgatagtggcgattggaatcctcag
ggcttagaaacagaaggttcgcgtgccgacagctttgagtatgtcatgtcaggaaaagtt
taccgtatcgagggtgacgaagcagcagtggaaccatcgagcagactagctgcttacgtg
tcgttcggagggcttctgatgcgactgcaaggggacgccaacaatttgcacagtttcgaa
gtggaccaacacatgtatttgttgatgaagaagatctttatgtaa

DBGET integrated database retrieval system