KEGG   Tribolium castaneum (red flour beetle): 658713
Entry
658713            CDS       T01046                                 

Symbol
sun, GLEAN_03214
Name
(RefSeq) stunted
  KO
K02135  F-type H+-transporting ATPase subunit epsilon
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca00190  Oxidative phosphorylation
tca01100  Metabolic pathways
Module
tca_M00158  F-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:tca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    658713 (sun)
SSDB
Motif
Pfam: ATP-synt_Eps
Other DBs
NCBI-GeneID: 658713
NCBI-ProteinID: NP_001164282
BEETLEBASE: TC003214
UniProt: D6WE43
Position
LG3:complement(78459..79121)
AA seq 59 aa
MSAWRAAGLNYINFSNIAARLLRRALKPEFRAEAAKRDESHIRITKWADGKPIRQESSA
NT seq 180 nt   +upstreamnt  +downstreamnt
atgtcagcgtggcgtgcagctggtctcaattacattaacttttcaaacatcgctgctaga
ttattgagaagagccttgaagcccgaatttcgggccgaagctgccaaacgggacgaatcc
cacattaggatcaccaaatgggcggatggcaaacccatcagacaggaatcctcagcttaa

DBGET integrated database retrieval system