KEGG   Tribolium castaneum (red flour beetle): 658823
Entry
658823            CDS       T01046                                 

Definition
(RefSeq) vacuolar protein sorting-associated protein 45
  KO
K12479  vacuolar protein sorting-associated protein 45
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:tca00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    658823
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tca04131]
    658823
Membrane trafficking [BR:tca04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    658823
SSDB
Motif
Pfam: Sec1 DUF2717 Not3
Other DBs
NCBI-GeneID: 658823
NCBI-ProteinID: XP_970273
BEETLEBASE: TC002297
Position
Un
AA seq 569 aa
MNLIAAVKAYVTKMTEESEPGMKILLMDKETTSVISMVYGQSEIQQKEVFLLERLDSPNQ
SNSLGLRYLKCLVFLRPTQENIGLLCNELRYPKYGAYYIYFSNIVAKADIKILAEHDEQE
VVKEVQELYMDYLAVNPHLFSIGLPTCMNSLSWNPTALQRTVQGIVAVLLSLKKSPAIRY
QANSKLCKDLGTRIDEVMNKESSLFAFGQNSHPLLLILDRRDDPMTPLLNQWTYQAMVHE
LLTINNNRVNLSGIPGVGKELSEVVLSAEQDPFYAKNIFLNYGEIGQNIKQLMDQFQAKA
KSHQKIESIADMKNFVEAYPQFKKLSGNVTKHVTVVGELSSMVNKYHLLDVSEIEQEISS
HNDHSSHLQSIKKLINNDKVRNTDIAKLVMLYALRYQNHSNNDVVGLIELLKKRGVSERL
IKNIVNILEYAGSHARQSDFLNVENALQSTKRFFKGLSGVDNVYTQHKPLIHETLEELVK
GRLKDSLYPYVGNHFLNGRPQDIIIFMVGGTTYEESLTVHSFNKSNPSFNIALGGTTIHN
STSFLAEVEQATRNLPRKHTRNIRNVRFD
NT seq 1710 nt   +upstreamnt  +downstreamnt
atgaacctaatagcagcagtaaaggcatatgtcaccaaaatgaccgaagagagcgaaccc
ggaatgaaaatcttattaatggacaaggagacaaccagtgtcatcagtatggtttacggc
cagtctgaaattcagcaaaaagaggttttcctgctcgagagattggattcaccaaaccag
agcaattcgttggggctgcgctatctaaaatgtttagtcttcctccgccccacgcaggaa
aacattgggttattgtgtaatgaattgcgttatcccaagtacggcgcttactacatctac
ttcagcaacattgtggccaaagctgacatcaagattttagctgaacatgatgagcaagaa
gttgttaaggaagttcaggagttgtacatggattatttagctgtgaaccctcatctgttt
tcaataggtttaccaacttgcatgaacagtctgtcttggaaccctacagctctccaaaga
acagttcaaggaattgttgctgttctcctctcattgaagaagagtccagcaatcagatat
caagccaattcaaagctttgcaaagaccttggaacacgaattgacgaagttatgaataaa
gaatcgtcattgtttgcgttcggccaaaacagccaccctttgttgctcattttggaccga
agagatgacccaatgactcctctcctaaaccagtggacatatcaagctatggtacatgaa
ctattaacaatcaataataatcgcgtcaacttatcgggaatccctggagtcggtaaagaa
ttatctgaagtggttttatcagcagaacaggacccattttatgccaaaaatatttttctg
aattacggcgaaattggacagaatatcaaacaactaatggatcagttccaagccaaagcc
aagagccaccaaaaaattgaaagtatcgcggatatgaagaattttgttgaagcttatcca
caatttaagaaactctcaggaaacgttactaaacatgtgacagtcgttggtgagttaagt
tcaatggtcaataaataccacctacttgatgtgtctgaaattgagcaggagatttcctca
cataatgaccactcatcacatttgcaaagcatcaagaagctaataaacaatgataaagtt
agaaatacagatattgcaaaattagtgatgctttatgcgttacgctatcaaaatcacagc
aacaatgacgtggtgggacttattgaattgctaaaaaagagaggagtttccgaacgtctt
attaagaatattgtcaatatattggaatatgcgggttcacacgctagacaaagtgatttt
ctcaacgtggaaaacgcccttcaaagcacgaagcggttctttaagggattaagtggagtt
gataatgtatacacgcaacataaacctttaatccatgaaacccttgaagaattggttaag
ggacgattgaaagacagcctttatccctacgttggaaatcattttctcaacgggagacct
caagacatcatcatttttatggtcggaggcacaacctacgaggagtctttaactgtacat
tccttcaacaaaagtaatccgagctttaatattgctcttggaggcacaacaatccataat
tctacgagctttttagctgaagttgaacaagctacgagaaatctacccagaaaacatacc
agaaatatccgtaatgttagatttgactaa

DBGET integrated database retrieval system