KEGG   Tribolium castaneum (red flour beetle): 658915
Entry
658915            CDS       T01046                                 
Name
(RefSeq) E3 ubiquitin-protein ligase TRIP12
  KO
K10590  E3 ubiquitin-protein ligase TRIP12 [EC:2.3.2.26]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:tca00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    658915
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:tca04121]
    658915
Enzymes [BR:tca01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.26  HECT-type E3 ubiquitin transferase
     658915
Ubiquitin system [BR:tca04121]
 Ubiquitin ligases (E3)
  HECT type E3
   658915
SSDB
Motif
Pfam: HECT WWE ANIS5_cation-bd
Other DBs
NCBI-GeneID: 658915
NCBI-ProteinID: XP_008200479
UniProt: D6WKR6
Position
LG5:complement(7545448..7557882)
AA seq 2052 aa
MADPANANAAASTSRRKRVLPPQPRAEAKRLCPQEDDSRHKVDTAKTSLANNKHPKSKNQ
EEFASTSRQIKKKQGVASTSRTSRSHPDIFELELPEVTRQKRNKNTTDINHKHNNIATTS
KHSTEPSSSSLDSFNSKASTSKSSSSSKHKLKKFRKNSKSPTTHKTEAKEHRGEKSGSSH
RLEKHRIRCKVEIKDSPRQRNNHRRSERYSSRSDIGLNHKKYESEESLSSENSVHKYPLR
SRSFTDQSSQTSHQSRKSPSGRVKRELVALGATSSQPNTREEQEPSRLTRSGAVLRRSTR
NSKAHSSTTGSCASSSGASGSGSSSRRAARQHKVGAAAPALLTAPATHAAAAMAADQPDM
PNNGLSASEEPPSPQEATQAMPSSGGPSGPGADSESEDSEVGRLQALLEARGLPPHLFGA
LGPRMQHLLHRSMGSNSSVARAQALLPGLQATGDEGQQLQAVIEMCQVLVMGNEEILTGF
PVKPVVQALITLLGMEHNFDIMNHACRALTYMMEALPRSSAIVVDAVPVFLEKLQVIQCM
DVAEQSLTALDMLSRRHSKAILQARGVSACLMYLDFFSINAQRNALSITANCCLNLTSEE
FQYVQESLPLLASRLTQQDKKCVESVCLAFSRLVDSFQLEPARLQEIASTELLTNLQQLL
VVTPPVISTGTFITVLRMLSVMCANCPDLALTLLKQNIAETLLYLLTGSAEVNQDEVELI
PRQPQEQFEITALIGELMPKLPSDGIFAVDALLERPSNVAKDQPVWQWRDDRGLWHAYGA
VDSRIIEAAHLNGDDEVSLNTLGRIYTIDFHSMQQINEDTGTSRPVQRRFTPTSAQSSGS
ESSHSGSRPNSASRDARVACLREERGLAAAFIRSLFSVLYEVYSSSAGPAVRCKCLKALL
RMVYYASPELLKDVLKNQVVSSHIAGMMASSDLRIVVGALQMAEILMNKLPEEFGVHFRR
EGVIHQINRLADPEIPLGVSPPKSSYSSASFSSTLNEPSTSQPSSSSSHIANGSATSSHI
GTPLSSAMYTSTPDTQRVQESETRSPSPSHVRLSDVLKRKRVPKRSGVSSRSKTRHEDLP
ISPSLMQDLFTKAASLGTSTPSNSSRPRYSGSSSKTSFLQSLNPARWGRTMNSSHDRNYS
KDALNSLTKSASNSHITAGNREKTRTWVREQASKFIETYSANEEDHHPATNVITRLKSAI
EKLPTIRCAEALRELREILIDSDVSPFEVNYSGLIKSLLVYLADVEGPFDRDQRLRIMLN
VFAGCPLEANVTEITQLNSAWMSALVAKLNGCVSQLEQFPVKVHDLPASSGAGRGGTSAL
KFFNTHQLKCNLQRHPDCTNLKQWKGGTVKIDPLALVQAIERYLVVRGYGRLRDKDSADS
DDGDSDDDIDDTLAGVVISQSGARHKLQFLIGNNVLPYNMTVYQAVRQFSNNGNDQSETD
TDNETPLGNVGIWVQTHVIYYRPLKEDGSSSGKPSSSSGTSSSHSSRKGKGSSSKSTSRR
KGDDLWNEGITPLVHSPLSPFLTTQLPDSVTIQDASLEVLCLLRILNALNLYWSTLYPAI
EYRPIVSPSEFLNSKIAAKASRQLQDPLVIMTGNLPNWLQQIASVCPFLFPFETRQLLFY
ATSFDRDRALQRLLDMSPELSSSDSQERVTPRLDRRKRTISRIDILKQAEQVMQDLASSK
ALLEVQYENEVGTGLGPTLEFYALVSKELQKSNLELWNAPDSHSSEYVNCPAGLFPSPLP
RGAKVGQITKVKSKFRFLGKFMAKAVMDSRMLDLPFSLSFYRWLLGQEHCLILADLKYVA
PEIYKNLKKMHAIVRQRDAILQDPNLTPEQKEEEVEKLEFDGCPISELGLDFVLPGHNVE
LIKNGKSTHVTIHNLHLYIKLVTHWMLVEGVNRQMESLREGFESVFPLQNLRVFQPEELE
AVFCGSPRDSIAGWDIKTLMECCKPDHGYTPDSRAIRFLFEVLSSYDREEQRMFVQFLTG
SPRLPVGGFKALSPPLTVVRKTLEPNMNPDDFLPSVMTCVNYLKLPDYTSIEVMRMKLHL
AASEGQHSFYLS
NT seq 6159 nt   +upstreamnt  +downstreamnt
atggcagatccagctaacgcaaacgctgctgccagcacaagccgccgcaagcgtgtgctg
cccccgcagccacgtgccgaggccaagcgcctttgcccccaggaagacgactctagacat
aaagtggacaccgcaaagacaagtctggctaacaacaaacacccaaaatcaaaaaatcag
gaggaattcgcgtcaacttcgaggcaaatcaaaaagaagcaaggcgttgcttcaacgtca
aggacgtcgagatctcatcctgatatttttgaactagaactacccgaagttacgaggcaa
aagcggaacaagaacactaccgatattaatcataaacacaacaatattgcgactacttcg
aaacatagcactgaaccttcttcaagttcgttagatagtttcaattccaaagcgagcact
tcgaaatcttcctcttcttcgaaacataagttaaagaaattcaggaaaaactccaagtca
ccgactacacacaaaaccgaggctaaggaacatcgcggcgagaaatccggttcttcacat
aggttagaaaaacataggattaggtgtaaggtggaaatcaaggattctccaagacagaga
aacaaccatagacgttcagaacgctatagcagcagaagtgacataggtctgaaccacaag
aaatacgaatcggaggagagcctgagtagtgagaacagcgtgcataaatatcctctccga
agtcgtagctttaccgaccagagctctcaaaccagccatcaatcaagaaagtcaccatcc
ggacgagtaaaacgtgaacttgtagcactgggggcgaccagcagtcagcctaatactcgt
gaggagcaggagccctctcgcctcacgcgaagcggagcagtgctgaggcgtagcacacga
aatagcaaagcgcacagctcaacaacgggttcctgtgcaagctcgagcggcgcaagtggc
agcggcagcagctcgagacgagcagcgaggcagcataaggtgggggcggccgctccggct
ctccttacagcccctgccactcacgctgccgcagccatggccgccgatcaaccagatatg
cccaacaatggcctgtcagcttcggaagagccaccgtctccacaggaggccacacaggcg
atgccttccagcgggggcccttccggacctggggccgactccgaaagcgaggacagcgaa
gtggggcgtctgcaagctctcttggaggcgagaggacttcctccgcatttgtttggcgca
ttaggccctcgaatgcagcatttgttgcacaggagtatgggatccaacagctctgtcgct
agagcacaagcacttttaccaggtctacaagctacaggtgacgaaggccaacagctacaa
gctgtcatagagatgtgccaagtgttggtgatgggtaacgaggagattcttaccggcttt
cctgtcaagccagtagtacaagcattgatcactctgctgggaatggagcataattttgat
attatgaatcatgcttgtcgtgctttgacctacatgatggaagctcttccaagatcatct
gcgattgtcgtagatgctgttcctgtttttctcgagaaactacaagttatacagtgtatg
gatgttgcagaacagtcgcttactgcgcttgatatgctgtctcgtcgtcattctaaagcg
attttacaagcgcggggcgtttctgcgtgcttgatgtacttggatttcttttccataaac
gcccaacgcaacgccctttcaatcacggcaaactgttgcctaaacctgacatcggaagaa
ttccaatacgtacaagaatcattgcccttgttagcaagccgtttaacccaacaagataaa
aaatgtgtcgaaagcgtttgcttggcattttcgcgtttggtcgatagttttcaattagaa
ccagcacgtctccaagaaattgccagtactgaacttctaaccaacttacaacaacttcta
gttgtgaccccacctgtaataagcaccggaacattcatcacagttttaagaatgctatca
gtcatgtgtgccaattgtcccgatctagctttaactctcctcaaacaaaacatagccgaa
actttgctgtatttactgaccggatctgcggaagttaaccaggatgaagtggagctaata
ccaaggcaaccgcaggaacagttcgaaatcacggctcttattggcgaactgatgcctaaa
ctgccatctgatggtattttcgctgtagatgccttacttgaacggccctcgaacgtggcg
aaggaccaaccggtgtggcaatggagggatgatcgtgggttgtggcacgcttatggtgct
gtcgatagtcgtataattgaggcagcgcatcttaacggcgacgatgaagtcagtttgaac
actttggggcgcatttatacgattgattttcattccatgcaacaaatcaacgaagatacg
ggtacttcaagaccggttcaacgtcggttcacaccaactagtgcccagtcaagtgggtct
gaatcatcgcattcgggaagtcgcccgaattcagcaagtcgtgatgctcgcgttgcgtgc
cttcgcgaggagcgcggccttgcagccgcgtttattcgttcgttgttctccgtattgtac
gaagtgtactcgtcgagtgccggaccggcggttagatgtaagtgtttgaaagccttattg
aggatggtgtattatgccagtcccgaactgttgaaagacgttttgaaaaaccaagtcgtg
agtagtcatatcgccggtatgatggcgtctagtgatttaagaatcgttgttggtgccttg
caaatggctgaaattcttatgaataagttacctgaagagttcggggtgcactttaggcga
gagggcgtcatacaccagattaaccgacttgcggaccctgagattccattaggcgttagc
cccccaaaatcgagctacagctccgcttcattttcctcaactttgaacgaacctagcact
tctcaaccctcgagcagctccagccatatcgcgaacggttcagcgaccagttcccacatt
ggcactcccctgtcctcagcaatgtacacttcgactccagacacccaacgtgttcaagaa
tccgaaactcgttcacctagtccctcacacgtacgattaagtgacgtattgaaacgtaaa
cgggtaccgaaacgatcaggagtgtcgagtcgttccaagacacgtcacgaagatctccct
atatcaccatccctaatgcaagatttgttcacaaaagctgcatctttgggcacctcaaca
cccagcaattcgtcaagacctcgatattcaggctccagttcaaaaactagtttcctacag
agcctgaatccggcgagatggggaagaacaatgaattcctcacacgatcgtaattacagc
aaagatgccttgaatagtctgaccaaatcggcgtcaaactcgcatatcaccgctgggaat
agagagaagacaaggacttgggtccgcgaacaagcttcgaagttcattgaaacttattca
gcgaatgaagaagaccatcatcctgctacaaacgtaatcacgagattgaaatcggcgatt
gaaaagttgcccacgattcgttgtgctgaggctttgcgcgagttgcgcgagattttgata
gattcggatgtttctccattcgaagtaaattattcggggctgattaagtccctgttggtg
tatttggccgatgttgaggggccgtttgaccgtgatcaaagactgaggatcatgctgaac
gtattcgctggttgtcccttggaagcgaacgtgactgaaataacacagttgaattcggct
tggatgagtgcgcttgtggcgaaactgaacggctgcgtctcgcaattggaacagtttcct
gtgaaagttcacgatttgccggcgagttcgggcgctgggaggggtggaactagtgctctt
aagtttttcaatacacaccagttaaagtgcaatttacaaaggcaccccgattgtaccaat
ttgaagcagtggaagggtggtacggtcaaaatcgatcctcttgccttggtgcaagcgatc
gagcggtatttggtcgttcgcgggtacggccgtttgcgtgataaagacagtgccgatagt
gatgatggtgattccgacgatgatatcgacgatacgttggcgggggttgtcatatcgcag
tctggagctaggcataagttacaatttttgataggcaacaatgttttaccttacaatatg
acggtgtatcaggctgtacgacagtttagtaataatggcaatgaccaaagtgagacggat
acggataacgaaactcctttagggaacgttggtatttgggtccaaacacacgtaatttat
tatcgaccattgaaggaagatggttcatcgtctggcaaacctagttcatcgagtggaacg
tcttcgagtcactcgagcaggaaagggaaggggtcgtcaagtaagagcacttctcggcgt
aaaggagacgacttatggaacgaaggaataacacctctcgttcactcgcctttgtcgccg
tttttaacgactcaattgcccgattcggtgacaattcaagacgcctcgttggaagtgttg
tgtcttttgcgtatcttgaacgctctcaacctctactggagcactctgtaccccgccata
gaatacagaccaatcgtttcaccgtcggaatttctcaatagtaaaatagcggcaaaagcc
agccgccagcttcaagaccccttagtcataatgaccggtaacctccccaactggcttcaa
caaatcgcctcagtctgtcctttcctgttcccgtttgaaacacgtcaactactattctac
gctacttcattcgaccgagaccgggccctacagcgcctcctggacatgtcaccagaattg
agttctagtgactcgcaagaacgcgtcactccacgactggatcgaagaaaacgcaccatt
tctcgaattgatattttgaaacaggccgaacaagtgatgcaagacttggcgtcgtcgaaa
gcactcctggaagtgcaatacgagaacgaagtcggtacgggattaggacccacgttggag
ttctatgctcttgtatcgaaagaattgcaaaagagtaatttggaattgtggaatgcaccc
gattcgcatagcagcgagtacgtgaattgtccagccggtttgttcccgtcgccgttgccg
agaggcgcaaaagttggacagattacgaaagttaagagcaagtttcggtttttgggcaag
ttcatggccaaggcggttatggattcgagaatgttggatcttccgttttcgttgtcgttt
tatcgctggctgttgggacaagagcattgcttgatccttgccgatcttaagtatgtagca
cccgagatttacaagaatttgaagaagatgcacgccatcgtgagacaacgggatgccata
ttgcaagaccccaacttgacaccggaacaaaaggaggaagaggtcgagaagctggagttt
gacggctgcccgatcagcgagctcggcctagacttcgttcttcccgggcacaacgtggag
ttgataaagaacgggaagtcgactcacgtcacgatccacaatttgcacctttacataaaa
ctggtgacacactggatgctggttgagggcgttaaccggcagatggagtcattgcgcgaa
ggattcgagtccgtatttccgttgcaaaacctgcgtgtgttccaacctgaagaactggag
gcggtgttctgcggcagtccgcgcgattcgatcgccggttgggacatcaagacgttgatg
gagtgttgcaaaccggatcacgggtacacacccgattccagagcgatcaggttcctgttt
gaagtattgagttcatacgaccgcgaggagcagaggatgtttgtgcagtttttgaccgga
agtccgcgtctaccggtcggagggtttaaggcactgtcgccaccgctgactgtggtccgg
aaaactttggaacccaacatgaaccctgatgattttctcccgtctgtgatgacttgtgtt
aactacctcaaattacctgactatacaagcattgaagtgatgcggatgaaacttcacttg
gctgcctctgaaggacagcattccttctatttatcataa

DBGET integrated database retrieval system