KEGG   Tribolium castaneum (red flour beetle): 658950
Entry
658950            CDS       T01046                                 
Symbol
Cox7c, cox-c
Name
(RefSeq) cytochrome c oxidase subunit VIIc
  KO
K02272  cytochrome c oxidase subunit 7c
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca00190  Oxidative phosphorylation
tca01100  Metabolic pathways
Module
tca_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:tca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    658950 (Cox7c)
SSDB
Motif
Pfam: COX7C TGF_beta_GS
Other DBs
NCBI-GeneID: 658950
NCBI-ProteinID: NP_001156931
BEETLEBASE: TC030047
UniProt: D6WSM8
Position
LG7:14424335..14424868
AA seq 66 aa
MLHRSSLFARKAISNFVRNHGHGGVPGENLPFDISNRYKLTALFIAFFGSGFGAPFLILR
HQLLKK
NT seq 201 nt   +upstreamnt  +downstreamnt
atgttgcaccgcagctcgttgtttgcaagaaaagcaattagcaatttcgtcagaaatcat
ggacatggaggtgttcccggagagaatttgccctttgacatcagcaataggtataagttg
acagccctcttcattgcattctttgggtctggatttggggctcctttcctcatcttgaga
caccaacttctcaagaagtaa

DBGET integrated database retrieval system