KEGG   Tribolium castaneum (red flour beetle): 659005
Entry
659005            CDS       T01046                                 
Name
(RefSeq) mitochondrial inner membrane protease subunit 1
  KO
K09647  mitochondrial inner membrane protease subunit 1 [EC:3.4.21.-]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca03060  Protein export
Brite
KEGG Orthology (KO) [BR:tca00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    659005
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:tca01002]
    659005
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:tca03029]
    659005
Enzymes [BR:tca01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-
     659005
Peptidases and inhibitors [BR:tca01002]
 Serine peptidases
  Family S26: signal peptidase I family
   659005
Mitochondrial biogenesis [BR:tca03029]
 Mitochondrial protein import machinery
  Inner mambrane
   Other inner membrane factors
    659005
SSDB
Motif
Pfam: Peptidase_S26 Peptidase_S24
Other DBs
NCBI-GeneID: 659005
NCBI-ProteinID: XP_970438
UniProt: D2A2K7
Position
LG4:complement(2000925..2001653)
AA seq 150 aa
MRKLFWKTLGSVGFVIQYACVAHCTFEYLGDFVLCSGPSMEPTIYSDDILLTEHVSARLN
RIDRGNIVIAKCPSNPKQNICKRVVGLPGDKIRLGFNNYEIVPRGHVWLEGDNSGNSSDS
RNYGPVPQGLIRSRALCRVWPLKDIKLLTN
NT seq 453 nt   +upstreamnt  +downstreamnt
atgcggaagcttttttggaaaacgctgggttcggtgggctttgtaattcaatatgcctgt
gtggcacactgcactttcgaatatctaggcgattttgttctgtgttcagggccttcaatg
gagccaacgatttactccgatgatattttactaactgaacacgtcagtgctaggctgaat
cgaatagatagaggaaatattgtcatagctaaatgtccttccaaccctaagcaaaatatc
tgtaagagagtggttggtttaccgggggataaaattaggcttggttttaataattacgaa
atcgtgcctagaggtcacgtgtggttggagggcgataattcgggtaattcttccgattct
aggaactatgggccagtgccccaagggctcatccgcagtagggccctgtgtcgagtctgg
cccttgaaggacattaaattgttaaccaactaa

DBGET integrated database retrieval system