KEGG   Tribolium castaneum (red flour beetle): 659087Help
Entry
659087            CDS       T01046                                 

Definition
(RefSeq) cathepsin O
  KO
K01374  cathepsin O [EC:3.4.22.42]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca04142  Lysosome
Brite
KEGG Orthology (KO) [BR:tca00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    659087
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:tca01002]
    659087
Enzymes [BR:tca01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.42  cathepsin O
     659087
Peptidases [BR:tca01002]
 Cysteine Peptidases
  Family C1: papain family
   659087
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C1 Inhibitor_I29 Peptidase_C1_2 NifW
Motif
Other DBs
NCBI-GeneID: 659087
NCBI-ProteinID: XP_970512
UniProt: D2A0S2
Position
LG4
AA seq 329 aa AA seqDB search
MASWSTYLQAIFYIALLFFVIPIRIKGPDQAESQFQEYLKRFNKTYDDPSVYQNRLHAFK
QSLQTIETLNSKKRNGSALYGLTKFSDLLPEEFFQTYLQSNLSQKTHSNEPKRHHHKRAT
VPNKVDWREKNAVTRIYNQGSCGACWAYSVIETVESMNAIKTNKSEELSVQEIIDCAGNN
KGCNGGDICTLLSWIKATNFTIQRHADYGGKCGRGSAGVHVRDFMCEGLVGSEDVMLRLL
ADNGPLAVAINAQTWQNYIGGVIEYHCDGDPSKLNHAVQIVGYDLTASIPHYIVRNTWGV
DFGDGGFLYIAVDKNMCGIANEVSALRVL
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atggcttcgtggagcacttacttgcaagcgattttctacattgctctgttatttttcgtt
atccctataagaataaaaggcccagaccaagccgaatcacaatttcaagagtacttgaaa
aggttcaacaagacatacgatgacccttctgtgtatcaaaaccgtcttcatgcatttaag
caatcactacaaacaatcgagactttgaattccaaaaaaaggaatggttcagcactgtac
ggtttaacgaaattctcggacttgttaccagaggaatttttccaaacctatttacaatca
aacctgagtcagaagacgcattcaaatgagccaaaacgacaccaccataaacgagcaaca
gtgcctaataaagtagattggagagaaaaaaacgcagtgactagaatttacaaccaaggc
agttgtggggcctgctgggcctactctgttattgaaactgtggagtccatgaacgccatc
aaaaccaacaagtctgaggagctcagtgtgcaagaaattatcgattgcgctggtaacaac
aaagggtgcaatgggggcgatatttgcactttactgtcttggatcaaagccacaaatttc
acgattcaaagacacgccgattatgggggtaaatgtggccggggctcggctggtgtccat
gttagagacttcatgtgtgaaggattagtggggtctgaagatgttatgttgaggcttttg
gcggataatggacccctggctgttgcgattaatgcgcaaacttggcagaattacattgga
ggtgttattgagtatcactgtgatggggatccgtcaaagttaaatcatgctgtccagatt
gttgggtatgatttgactgcaagtattccgcattatattgtcaggaatacgtggggtgtg
gactttggggacgggggatttttgtacatagctgtggataaaaatatgtgtgggatcgca
aacgaggtctcagcattaagagtactgtga

DBGET integrated database retrieval system