KEGG   Tribolium castaneum (red flour beetle): 659177
Entry
659177            CDS       T01046                                 

Definition
(RefSeq) protein shuttle craft
  KO
K12236  transcriptional repressor NF-X1
Organism
tca  Tribolium castaneum (red flour beetle)
Brite
KEGG Orthology (KO) [BR:tca00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:tca03000]
    659177
   04121 Ubiquitin system [BR:tca04121]
    659177
Transcription factors [BR:tca03000]
 Eukaryotic type
  Zinc finger
   Other zinc fingers
    659177
Ubiquitin system [BR:tca04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   NFX1 proteins
    659177
SSDB
Motif
Pfam: R3H zf-NF-X1
Other DBs
NCBI-GeneID: 659177
NCBI-ProteinID: XP_970597
UniProt: A0A139WHD1
Position
LG5
AA seq 963 aa
MSYWGPYEDQLNGGFPGCNPEYVQYFNNMSYYNDPNSANYSAVNYYDGQTTYQNNYLEQP
GTSQVTNNWAPNHSNEDVGAGTRKKTNERKYWNNGRKNERYGSGRTFTRSKPEQRKYPEN
DEKVDKFNQKQDGRSQNSNTRFRNNYRSRDKYDFYDGRGYGKYGKSSRSYEDNGASGRDW
RSSNANRKCASNVQKKFDAASQRERLEQMLSRRTLECLVCCEKIKHTDKIWTCQQCYHIF
HLNCTIAWANSSKLDSGWRCPACQNVCSDIPKQYTCYCGKTLEPRPLPGVVPHACGELCE
KTRRCDHKCTILCHPGPCPDCNVMVAKPCGCGATTQTVKCSADTEIVCGAICGKKLSCGV
HECGAKCHVGPCMECDRELRQICYCEKVGRKVKCREEFKGAVNYSCGEVCGRGLSCGNHT
CTKVCHEGDCEACPRDVGVVKTCPCGRSELKKRRESCLDPIPCCDKICGKILNCGQPAAP
HSCKLPCHEGPCPPCPLTTLIRCRCGHMDREIPCGQVTTKADDARCEKKCTKKRLCGKHR
CNQRCCIEIEHICPLPCNHMLACGQHRCERTCHSGRCPPCVETSFDELYCECGANVLYPP
IPCGTKPPPCNNPCSRPRPCGHEANHACHTGACPPCTVLCKRWCYGKHEQRSAIPCYQED
FSCGLPCGKAMPCGAHKCDKACHLGACTLPCKQKCNVKRVQCGHPCGVTCHEGPCPDTPC
RQMVPVTCPCGLQKATRPCIELAEAYKEIEMAHLKDKMADLLKDQAVDISDINKAKRPSV
LKILECTEECRVLERNRRLAIGLQIRNPDLSQKLTPRYSDFMRNWAKKDPQFCQKVHEKL
TELVQLAKQSKQKSRSYSFESMNRDKRHFVHEYCEHFGCESAAYDAEPNRNIVATAFKDK
SWLPSMSLLEFIQRENGQRKVPGPVLSKGTLGKSETVALKLPGRGQRGTPSGETVDYFDN
PPV
NT seq 2892 nt   +upstreamnt  +downstreamnt
atgtcgtattggggcccctacgaagatcagttgaatggcggattcccaggatgtaatcca
gaatatgtccaatatttcaacaacatgtcttattacaatgatcccaacagtgccaattac
agtgccgtaaattactatgacggtcaaacaacgtaccagaataactatttggagcagcct
ggaaccagtcaggtgactaataactgggccccaaatcactctaatgaggatgttggggcc
gggactaggaaaaaaacgaacgaaaggaagtactggaataacgggaggaagaatgaaagg
tacgggagtggtcgcacgtttactagaagtaagcctgagcaaaggaagtatccagaaaat
gatgaaaaagtagataagtttaatcagaagcaagacgggaggagtcaaaatagtaacact
aggtttaggaacaattatagaagtagggataagtatgatttttacgacgggagagggtat
gggaaatacgggaagtctagtaggagttacgaagataacggggccagtggacgggactgg
cgctccagtaacgcaaatcgcaagtgcgccagcaacgtgcaaaagaaatttgacgccgcc
tctcagcgcgagcgcctcgagcagatgctctcgcgtcgcacgctggagtgcctcgtctgt
tgcgaaaaaatcaaacacactgacaaaatctggacttgtcagcagtgttaccacatcttc
catctcaactgcaccatcgcctgggccaattcgtcaaaactagattcaggctggcgttgt
ccagcttgtcaaaacgtttgcagcgacattcccaaacagtacacttgctactgcggcaaa
acgctcgaaccgcgcccccttccaggcgtagtcccgcacgcttgtggcgaattatgcgaa
aaaacgcgccgttgtgaccacaaatgcaccattctgtgccacccggggccctgtcccgac
tgcaacgtcatggtggcaaagccctgcggttgtggggccaccacacaaacagtcaaatgt
agcgctgataccgaaattgtttgtggcgctatctgtggaaaaaaactctcatgtggggtc
cacgaatgcggggcgaagtgccacgtggggccatgtatggaatgcgatagagagttgaga
cagatttgttattgtgagaaggtggggcgtaaagtgaaatgtagggaggagtttaaagga
gcggtgaattattcgtgtggggaggtttgtgggcggggcttgagttgtgggaatcacacg
tgcactaaagtgtgtcacgagggggattgtgaggcgtgtccgagagatgtgggggtggtt
aagacgtgtccttgtgggaggagcgaattgaagaagagaagagaatcatgtctggatcct
ataccgtgctgtgataaaatttgtgggaaaatcctaaattgtgggcaaccggcagccccc
cactcctgcaaacttccatgtcacgagggtccgtgccccccatgcccccttacgaccttg
attcgttgtcgttgcggtcacatggaccgggaaatcccctgcggacaagtaacgacgaaa
gccgacgatgcccgatgtgagaaaaaatgtaccaagaaacgcctctgtggcaaacaccga
tgcaatcaacgttgttgcatcgaaatcgaacacatttgtcccctcccatgcaatcacatg
ctcgcttgtggccaacaccgttgcgagaggacgtgtcacagtgggcggtgcccaccttgc
gtggaaacaagtttcgacgaattgtattgcgaatgcggagctaacgtcttatacccgccc
attccatgcggcacaaaaccgcccccttgcaataatccatgttccaggccacgcccatgt
ggccacgaagccaatcatgcgtgccacacaggggcgtgtccaccgtgtaccgttttgtgc
aagaggtggtgttacggcaaacacgagcagagatcggctattccctgttatcaggaggat
ttcagttgtggattaccgtgtgggaaggccatgccgtgtggggcacataagtgtgacaag
gcgtgtcatttgggggcgtgtacgttgccatgcaaacagaaatgtaacgtgaagagagtc
caatgcgggcatccgtgcggggtcacgtgtcacgaagggccgtgtcctgacacgccctgt
aggcaaatggtgccggtcacgtgcccctgtggcttgcagaaagcaacaaggccttgcatc
gagttggctgaggcgtataaggagatcgaaatggcgcatttgaaggacaaaatggccgat
ttgttgaaggatcaagctgtggacatcagcgatatcaacaaagccaaaaggccgtcggtt
ttgaaaatattggagtgcaccgaagagtgtcgggttctggagcgcaaccggcggctggct
atcggtctgcagattcgcaacccggatttgagtcaaaaactgactcctcgttactccgat
tttatgcgaaattgggcgaaaaaagacccgcagttttgccaaaaagtgcacgaaaagctc
accgagttggtccaattggctaagcagagtaaacaaaagagtcgttcgtattcttttgag
tcaatgaacagagataagagacatttcgtgcacgagtattgtgagcattttgggtgtgaa
agcgccgcctacgatgcggaacccaaccgaaatatcgttgcaactgcctttaaggacaag
tcgtggttgccgagtatgagtctattggagtttattcagagggaaaatgggcagaggaag
gttccagggccggttctgagcaaagggacgttggggaagtcggagaccgttgccttgaaa
ttgcctggaagggggcagaggggaacgccatcaggagagaccgtggattatttcgataac
cccccagtgtaa

DBGET integrated database retrieval system