KEGG   Tribolium castaneum (red flour beetle): 659260Help
Entry
659260            CDS       T01046                                 

Gene name
thickveins, tkv
Definition
(RefSeq) bone morphogenetic protein receptor type-1B
  KO
K13578  bone morphogenetic protein receptor type-1B [EC:2.7.11.30]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca04013  MAPK signaling pathway - fly
tca04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:tca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    659260 (thickveins)
   04350 TGF-beta signaling pathway
    659260 (thickveins)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tca01001]
    659260 (thickveins)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:tca04090]
    659260 (thickveins)
Enzymes [BR:tca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     659260 (thickveins)
Protein kinases [BR:tca01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   659260 (thickveins)
Cytokine receptors [BR:tca04050]
 TGF-beta receptors
  Type I TGF-beta receptor
   659260 (thickveins)
CD molecules [BR:tca04090]
 Proteins
  659260 (thickveins)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Activin_recp TGF_beta_GS Pkinase_fungal Kdo FTA2 APH
Motif
Other DBs
NCBI-GeneID: 659260
NCBI-ProteinID: XP_008197076
Position
LG8
AA seq 505 aa AA seqDB search
MTKRKNRNMRARKQNVRRCYCEGHCPDGQRNGTCELRPGGKCFTTAQIGYDDNGDEYPLR
YYGCLPPDEGGIMQCKGHLVPHAEPKSIECCDGSDQCNLHLKPMYPERPTPDVPQYGPFD
SPPYIVLLTSVTFCITLCLIVIMICYLRYRKKQVFVNKDYPEKYPAMKIHRHHLIDEKSS
GSGSGMPTLVQRTISKQIHMIRSVGKGRYGEVWLARWRSERVAVKVFFTTEEQSWFRETE
IYQTVLMRHDNILGFIAADIKGTGSWTQMLLITDYHENGSLFDYLQDHVLDTNSLLTMVL
SIARGLAHLHTEIFGTRGKPAIAHRDIKSKNILVKSNLECCIADFGLAVKYFSDTNELDD
PRGASLVSTRSGTRRYMAPEILDNSINVRSFEAQKMADMYAFGLVLWEMSRRCITGDKIT
TADDYQVPYYDCVSSDPGFEEMMQVVCVKNMRPHIPMRWESEYVLKTLSKVMQECWHANP
SVRLTALRVKKSLSKLDTDSCIKIV
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaaggaagaacaggaacatgagggccagaaaacaaaacgtgagaagatgctac
tgcgaaggacactgtccggacggccaaaggaatgggacctgcgagctcaggcccggcgga
aagtgcttcaccacggcccagatcggatatgacgacaacggtgacgaatatcctctcagg
tactacggttgtcttccacccgacgagggaggcatcatgcaatgcaaaggccatctcgta
ccgcacgccgagcccaaatccatcgaatgctgcgacggctcggaccagtgcaacctccac
ctcaaacccatgtacccggaacggcccacccctgacgtcccccaatacggccccttcgac
agccccccgtacatagtcctcctcacgtcggtcacgttctgcataaccctctgcctcatc
gtgataatgatttgctacttgcggtatcgcaagaagcaagtttttgtaaataaagactat
cccgagaaataccccgcgatgaaaatccaccggcaccacctcatcgacgagaagagcagc
ggctcgggctcggggatgccgacgttagtgcagaggacgatttcgaagcaaattcacatg
atacgctcggtggggaagggtcggtatggagaggtttggttagcgaggtggcgaagcgaa
cgggtggcagttaaggtgtttttcacaacggaggagcagtcctggtttagggaaacggaa
atttaccaaactgtgttaatgaggcacgataatatactagggttcattgcggccgatatt
aaggggacggggtcctggacgcagatgttgctgattacggattatcacgaaaatggctcg
ctgtttgattatctgcaagaccatgtcttggacacgaattcgctgctcaccatggtcttg
agtattgcgagagggttggcacatctgcatacggagatattcggcaccagaggcaagccg
gcgatcgcccaccgcgacatcaagagcaagaacatcctggtgaagtcgaacctggagtgc
tgcatcgccgacttcggcctcgccgtgaagtacttcagcgacacgaacgagctggacgac
ccccggggggcgagcctggtgagcacccgcagcggcacgcgccgctacatggcccccgag
atcctcgacaacagcatcaacgttcgcagcttcgaggcgcagaaaatggccgacatgtac
gccttcggtttggtgttgtgggagatgtcgagacgttgcataaccggtgataagatcacc
acagcggacgattaccaagtgccatattatgactgtgtgtcgagtgatcccggtttcgag
gagatgatgcaggtcgtttgtgtgaagaacatgaggccgcacattcccatgcgctgggag
tcggagtacgtgctgaagacgctctccaaagtgatgcaggagtgctggcacgccaacccc
tccgtgcggctgacggccttgcgcgtgaagaagagcctgtccaagctggacacagactcg
tgcatcaaaatcgtctag

DBGET integrated database retrieval system