KEGG   Tribolium castaneum (red flour beetle): 659287
Entry
659287            CDS       T01046                                 

Definition
(RefSeq) exostosin-2
  KO
K02367  glucuronyl/N-acetylglucosaminyl transferase EXT2 [EC:2.4.1.224 2.4.1.225]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca00534  Glycosaminoglycan biosynthesis - heparan sulfate / heparin
tca01100  Metabolic pathways
Module
tca_M00059  Glycosaminoglycan biosynthesis, heparan sulfate backbone
Brite
KEGG Orthology (KO) [BR:tca00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00534 Glycosaminoglycan biosynthesis - heparan sulfate / heparin
    659287
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:tca01003]
    659287
Enzymes [BR:tca01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.224  glucuronosyl-N-acetylglucosaminyl-proteoglycan 4-alpha-N-acetylglucosaminyltransferase
     659287
    2.4.1.225  N-acetylglucosaminyl-proteoglycan 4-beta-glucuronosyltransferase
     659287
Glycosyltransferases [BR:tca01003]
 Glycan extension
  O-Glycan
   659287
SSDB
Motif
Pfam: Glyco_transf_64 Exostosin
Other DBs
NCBI-GeneID: 659287
NCBI-ProteinID: XP_976077
UniProt: D6WCJ9
Position
LG2
AA seq 706 aa
MTIHTKIAISKVYNYTHNTSLYKNFFFLVFIVLIVTTFTVLPRLRINIGDESSNFKKITL
VNIRNLPEFRLVGDSASPRNPECTHWDCFNIYKCGRTGHDRIAVYVYPPKKYVDEQGVPA
TELMSKEYLALLQAVVNSKYYTANPHEACIFIPSIDTLNQERLRPNLTSKALRSLPFWND
GENHLIFNMIAGNAPDFSPVVDLATGKALIAGADFNKYSFRTNFDVSIPLFSPIARPGDI
NHRRRSWLVTSSQLNLDVNYLGVLQKLSSRHNSLLILDACHRHNYTKRCRENSNEMVDYP
AILHESTFCLVFRGERIGQFALLEAMAANCIPVVVMDGAVLPFSNVIDWKRAAVFIMENY
LHTLVDVLEKISPQRIKQMQKTGRFLYDSYFSSIEKIALTTLDIIQDRVYPHWSKIYDDW
NLRPEEKNTNPLFLPLTAPKSHGFTAVILTYDRVDSLYTLIDRLSRVPSLMKVIVVWNNQ
KKSPPPLSSFPQIQKPVKVIRTSANKLSNRFYPYNEIETEAILHIDDDIVMLTADEVEFG
YEVWREFPDRIVGFPSRTHRWDNATNSWKYESEWTNEISMVLTGAAFLHKYWSFLYTTAM
PANIRELVDEHMNCEDIAMNFLVANVTNKPPIKVTPRKKFKCPECVNNEMLSADEGHMIE
RSQCVDRFVKAFGRMPLKSVEFRADPVLFKDPFPEKLKRFNDIGSL
NT seq 2121 nt   +upstreamnt  +downstreamnt
atgactatacatacaaaaatcgcaatatcgaaagtgtacaactacacccacaatacttct
ttatacaaaaatttcttttttcttgtgtttattgtactgattgtaactacgttcaccgtt
ttaccgagactacgtatcaatattggtgatgagtcttcaaacttcaagaaaatcactttg
gtaaacatcagaaacttgcccgaatttagattggtaggggatagtgcctcgccgagaaac
ccagaatgcacccattgggactgcttcaatatttacaaatgtgggcgcacgggtcatgac
aggatagccgtttacgtttacccgccgaaaaaatacgtagatgaacagggagtccctgca
actgaactcatgtcgaaggaatatttagctttactccaggctgtggtcaattccaaatac
tacactgctaacccgcacgaagcgtgcattttcattccatccattgataccttgaaccag
gaaagactcaggccaaacctcacctcaaaggctttaagaagcttgcctttctggaatgat
ggagaaaatcatctcattttcaatatgatagcaggaaatgctcctgatttttccccagtt
gtcgacttagccactggaaaggctctgatagctggagctgacttcaataaatactcattt
aggacgaattttgatgtctcgataccgttatttagtccaatcgctagacctggggatatt
aaccatcgtcgaaggtcgtggttggtgacgtcttcgcaactcaacctcgacgtcaactac
ttgggagttctccagaagctatcatcgcgccacaactcgcttttaatcctcgacgcctgc
catagacacaactacacgaaacgttgcagggagaattcaaacgaaatggtggattatcct
gcgattttacacgaaagcacattttgtctcgtttttcgaggcgaacgcatcggtcaattc
gctttattggaagcgatggccgccaattgtatccccgtcgtggtaatggacggggcagtg
ttgccatttagtaatgtgatagattggaaacgtgccgccgttttcatcatggagaattat
ttacacaccttagtggacgtactcgagaaaatttctcctcaacgtatcaaacagatgcaa
aaaactggccgattcctctacgattcgtacttctcaagcattgagaaaattgcactcacg
actttagatattatccaggatcgggtgtatccacactggtcgaaaatttacgacgattgg
aatcttcgaccagaggagaaaaatacaaatccgctgtttttgccgttgacggcaccgaaa
tcgcacggttttaccgcggttattttaacgtatgatcgagttgatagtctttacactttg
atcgataggttatcacgagttcctagtcttatgaaagttatcgttgtgtggaacaaccaa
aagaaaagtccgccgccattatcttcgtttcctcaaatacagaagccagtcaaagtcatt
cgaacaagtgccaataaattatctaatcgattttatccgtataatgagatcgaaactgag
gccattttacatatcgatgatgatatcgttatgttgacggcagacgaagtcgagttcggt
tatgaggtctggagggagtttccagatcggatcgtaggctttcccagtcgtactcacagg
tgggacaatgctaccaacagctggaaatacgaatcggaatggaccaatgaaatttcgatg
gttcttactggcgcagctttcctacacaagtattggagctttctgtacaccacagcaatg
ccagcaaacattcgcgagttggtagacgagcacatgaattgtgaggacattgccatgaat
tttctagttgcaaatgttacaaataagccaccgattaaggttacacctcgcaaaaagttc
aaatgtccggaatgtgtcaataatgaaatgctgtcggccgacgaaggtcatatgatagag
aggtcccagtgtgtggatagattcgtgaaagctttcggccgcatgcctttaaaatcggtc
gaatttcgagcagatcctgtattattcaaagatccattcccagagaagttgaaacgcttt
aacgacattggcagcttgtag

DBGET integrated database retrieval system