KEGG   Tribolium castaneum (red flour beetle): 659315Help
Entry
659315            CDS       T01046                                 

Definition
(RefSeq) succinyl-CoA ligase [ADP-forming] subunit beta, mitochondrial
  KO
K01900  succinyl-CoA synthetase beta subunit [EC:6.2.1.4 6.2.1.5]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca00020  Citrate cycle (TCA cycle)
tca00640  Propanoate metabolism
tca01100  Metabolic pathways
tca01200  Carbon metabolism
Module
tca_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tca_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:tca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    659315
   00640 Propanoate metabolism
    659315
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tca04147]
    659315
Enzymes [BR:tca01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     659315
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     659315
Exosome [BR:tca04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   659315
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp
Motif
Other DBs
NCBI-GeneID: 659315
NCBI-ProteinID: XP_970725
Position
LG5
AA seq 447 aa AA seqDB search
MATMLRSVLLAESVLLKNGPKILGSASWQPQQQQKRNLNVHEHISYTLLKDAGIQVPKFG
VAKTKQEARKIAEDLKTKDIVLKAQVLAGGRGKGHFKNGLKGGVRMVYSPEEAEDIAGQM
LGQYLVTKQTGEKGRICNAVMVAERKFPRKEFYFAIMMERAFGGPVIIASSQGGINIEEV
AAENPAAILYEPIDIVKGLSKEQAQKVAVNVGLGSQKEKTGDMLLKMYDLFCKKDALLIE
INPYAEDAGETYFSLDAKFRFDDNAAFRQKDLFALRDWTQEDEKEVAAAKFDLNYIALDG
SIGCLVNGAGLAMATMDIISLHGGSPANFLDVGGGATAQAVKEAFKIITADPKVHAILVN
IFGGIMRCDVIAEGIIAAAKELNLKMPIICRLQGTNVDDAKVLIASSGLKILPVDNLDEA
ARLAVKLSNIVSLARDAKLDINFEIPL
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atggctacaatgttgcggagcgtccttttggccgaaagcgttctcctgaaaaacggacca
aagattttgggctctgcaagttggcagccacagcagcaacagaagcgaaatttaaatgtt
cacgaacatatcagttacacccttctcaaggatgctggtatccaggtccccaaattcggg
gttgccaagaccaagcaggaggcgcgcaaaatcgccgaagacttgaaaaccaaagacatt
gtacttaaagcgcaagttttggcaggtggcaggggcaaaggtcacttcaagaacggactc
aagggtggagtcaggatggtttattcgccagaagaggccgaggacattgctgggcaaatg
cttggccaatatttagtcactaaacaaactggggaaaaggggcgcatctgcaacgctgtt
atggtcgcagagaggaaattccccaggaaggaattctactttgcaattatgatggaacgc
gcgtttggcggtcctgtaataatagcttcctcccaaggaggtatcaacattgaagaagtg
gctgctgagaatcccgccgctattttgtacgaaccaatcgacattgtcaaaggtttgagc
aaagaacaagcccaaaaagtggccgtcaacgtcggtttggggtctcagaaggagaaaact
ggtgacatgttgctaaaaatgtacgatttgttttgcaagaaggacgccctcctgattgag
atcaacccttatgccgaagatgcgggagaaacatatttctcgcttgatgcaaaattccga
tttgacgacaacgctgctttcagacagaaagatttgtttgctttgcgtgattggacccaa
gaggacgagaaagaggtggctgcggccaaattcgatctcaactacattgctctcgacggc
agtattgggtgtcttgtgaatggggctggtcttgccatggccaccatggacattatctct
ctgcatggtggctcccctgctaatttcctggacgtgggaggtggggccacagcccaggct
gtcaaagaagccttcaaaattatcacagcggatcccaaagttcacgcaattcttgtgaat
attttcggcggtattatgaggtgtgatgtcatagcggagggtattattgccgctgctaaa
gaactcaacctcaaaatgccgattatttgccgtttgcaaggcacgaatgtcgacgatgcc
aaagttttaattgccagctcagggttgaagattttgccagttgataaccttgatgaagcg
gctcgtttggctgttaaactgtctaatattgtcagtctggcgcgcgatgcgaagctagat
atcaattttgagattccattgtaa

DBGET integrated database retrieval system