KEGG   Tribolium castaneum (red flour beetle): 659386
Entry
659386            CDS       T01046                                 
Name
(RefSeq) actin-related protein 2/3 complex subunit 5
  KO
K05754  actin related protein 2/3 complex, subunit 5
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:tca00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    659386
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tca04131]
    659386
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:tca04812]
    659386
Membrane trafficking [BR:tca04131]
 Others
  Actin-binding proteins
   Arp2/3 complex
    659386
Cytoskeleton proteins [BR:tca04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Arp2/3 complex
     659386
SSDB
Motif
Pfam: P16-Arc Utp12
Other DBs
NCBI-GeneID: 659386
NCBI-ProteinID: XP_008193030
UniProt: D6WJE2
Position
LG5:complement(4028054..4028801)
AA seq 150 aa
MAKNTSSSAFRKIDVDQYCEDNFKEDDGDQGGPTGPDESEVNGLLQKGKHLEALKAVLVN
APLGSKNQQIKENAVSLTLRVLLAIKPSQIEEAVNSLNPDLVDVLMKYIYRGFEYPSEGS
SGHLLVWHEKVFNVGGVGCIVRVLSDTRRA
NT seq 453 nt   +upstreamnt  +downstreamnt
atggcaaagaacacgtcgagttcagctttcagaaaaattgatgttgatcaatactgtgaa
gacaatttcaaagaagacgatggtgatcaagggggtcccactgggccggatgagtcagaa
gtcaacggtttactgcaaaaaggtaaacatttagaggcactcaaagctgtgcttgtgaac
gccccgcttggaagcaaaaatcaacaaatcaaagaaaacgccgttagtttaacgctgagg
gtcttgttggctatcaagccttcccagattgaggaagctgttaattcgttaaaccctgac
ttggtcgacgtgttgatgaaatacatctaccgcgggttcgaatatccttcggaaggaagc
agtggccatttactggtatggcatgagaaagtattcaacgttgggggagttggatgtatt
gtaagagtgctgtctgacaccagacgagcttaa

DBGET integrated database retrieval system