KEGG   Tribolium castaneum (red flour beetle): 659458
Entry
659458            CDS       T01046                                 
Name
(RefSeq) 60S ribosomal protein L35
  KO
K02918  large subunit ribosomal protein L35e
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca03010  Ribosome
Brite
KEGG Orthology (KO) [BR:tca00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    659458
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:tca03011]
    659458
Ribosome [BR:tca03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    659458
SSDB
Motif
Pfam: Ribosomal_L29 Snapin_Pallidin APOBEC_C
Other DBs
NCBI-GeneID: 659458
NCBI-ProteinID: XP_970855
BEETLEBASE: TC014007
Position
LG5:4028918..4029638
AA seq 123 aa
MGKVKCSELRTRDKKELTKQLDELKTELTSLRVAKVTGGAPSKLSKIRVVRKAIARVYIV
MHQKQKENLRKLYKNKKYKPLDLRPKKTRALRRALTKHERRIKTPKELHKRSIYPQRKFA
LKA
NT seq 372 nt   +upstreamnt  +downstreamnt
atgggtaaggtaaagtgctccgaactgcgaactcgcgacaagaaggagctcaccaagcag
ctcgatgagctcaaaaccgagctcacaagtctcagggtggccaaagtgacgggcggcgcc
ccctcgaaactgtccaagattcgcgttgtacgcaaagccatcgctcgcgtgtacattgtg
atgcaccagaagcaaaaagagaatttgcggaagttgtacaaaaacaagaaatacaagcct
ctggatttgagacctaagaagaccagggctttgcggcgtgcgctcaccaaacacgagaga
cgcatcaagacgcccaaggagctccacaagaggtcgatctacccccagaggaagttcgcg
ttgaaagcttaa

DBGET integrated database retrieval system