KEGG   Tribolium castaneum (red flour beetle): 659459
Entry
659459            CDS       T01046                                 

Symbol
nuoF
Name
(RefSeq) NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial
  KO
K03942  NADH dehydrogenase (ubiquinone) flavoprotein 1 [EC:7.1.1.2]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca00190  Oxidative phosphorylation
tca01100  Metabolic pathways
Module
tca_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:tca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    659459 (nuoF)
Enzymes [BR:tca01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     659459 (nuoF)
SSDB
Motif
Pfam: Complex1_51K NADH_4Fe-4S SLBB
Other DBs
NCBI-GeneID: 659459
NCBI-ProteinID: NP_001164305
BEETLEBASE: TC014119
UniProt: D6WKB4
Position
LG5:5891209..5895177
AA seq 478 aa
MAGTLARFTNVARSHYGLVATTCSNAQVALFSTPPPGTPPPQTKTTFGPLSDEDRIFTNL
YGKHDWRLKGALKRGDWYKTKEILLKGSDWIINEIKTSGLRGRGGAGFPSGMKWSFMNKP
GDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLVEGCLIAGRAMGAKAAYIYIRGEFYNE
ASNMQVAIAEAYQAGLLGKNACGSGYDFDVFMHRGAGAYICGEETALIESIEGKQGKPRL
KPPFPADVGVFGCPTTVTNVETVAVSPTICRRGGTWFASFGRTRNSGTKLFNISGHVNRP
CTVEEEMSITFKELVERHAGGIIGGWDNLLAIIPGGSSTPLIPKSVCEDVIMDFDGLVAA
QTSLGTAAIIVMNKQTDIVKAIARLIMFYKHESCGQCTPCREGINWMNKIMYRFVDGNAK
PEEIDMLWELSKQIEGHTICALGDGAAWPVQGLIRHFRPELEERMRKFHEQNRSAARC
NT seq 1437 nt   +upstreamnt  +downstreamnt
atggcaggcacattagctagatttacaaatgtagcaagaagtcattatggactcgttgct
acaacttgcagcaatgcccaagtggcactcttttccacacctcctccaggcactccacca
cctcaaacaaagacaacttttggcccactttccgacgaggaccgcatatttacaaacttg
tatggcaaacatgactggcgtttgaaaggggccctgaagagaggtgactggtacaaaacg
aaggaaattttacttaagggctcagactggatcataaatgagatcaaaacatctggtcta
cgtggtagaggaggcgccggtttcccctcaggcatgaagtggtcgttcatgaacaaaccg
ggagacggccgtcccaaatacctcgtcgtcaatgctgacgagggagaacctggcacttgc
aaagacagggaaattatgagacatgatcctcacaaattggtagagggctgtcttattgcc
ggcagggcaatgggggcgaaagcggcttatatttacattagaggcgaattttacaatgaa
gcatcgaatatgcaagttgctatagctgaagcttatcaagctggcttactgggcaaaaat
gcatgtggttctggatacgatttcgatgtttttatgcatagaggcgcaggagcgtatatt
tgtggcgaggaaactgcgctgattgaatctattgaaggaaagcagggtaaaccgaggttg
aagcctcctttcccggctgatgtgggggtttttgggtgccccactactgtgactaacgtt
gaaactgtcgccgtgtcacccacaatttgtcgtcgtggaggaacatggtttgcctcattt
ggcagaacccgaaattcgggaactaaacttttcaatatctctggtcacgtcaaccgacct
tgcaccgttgaagaagaaatgagtattacattcaaagaattagtagaacgccacgctggt
ggtatcattgggggttgggacaaccttttggccatcattcctggtggttcttccacaccg
cttataccgaaaagtgtttgcgaggacgttatcatggatttcgacggcctggtcgcggcc
cagacaagcttgggaaccgctgccatcattgtgatgaacaagcaaaccgatattgtcaaa
gctatcgccagattgatcatgttttacaagcacgagtcctgcggccagtgcactccttgc
cgcgaaggaatcaattggatgaacaaaatcatgtacagatttgttgacggcaatgccaaa
cccgaggaaatcgacatgttgtgggagctgagtaagcagatcgaagggcacaccatttgc
gctctcggcgacggtgctgcgtggccagttcagggactcatcaggcattttagaccagaa
ttagaagaaagaatgaggaagttccatgagcaaaataggagcgctgctcggtgttaa

DBGET integrated database retrieval system