KEGG   Tribolium castaneum (red flour beetle): 659509
Entry
659509            CDS       T01046                                 

Definition
(RefSeq) NF-X1-type zinc finger protein NFXL1
  KO
K15683  NF-X1-type zinc finger protein NFXL1
Organism
tca  Tribolium castaneum (red flour beetle)
Brite
KEGG Orthology (KO) [BR:tca00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:tca04121]
    659509
Ubiquitin system [BR:tca04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   NFX1 proteins
    659509
SSDB
Motif
Pfam: zf-NF-X1 RP854
Other DBs
NCBI-GeneID: 659509
NCBI-ProteinID: XP_008191258
Position
LG3
AA seq 849 aa
MAARKKESNVWKKNTNHNRGGNTLVNSPTPAELKFKEAHGKLQAAVQKYVQDYESSSSED
ELESDNIIGEIIKNYTKTGAKDEYLGRTKTFLQDSFLSGTVTCLICISRIKRDSSIWNCN
ECYCVFHLTCIQRWSKDSIFQQKQIQEGPIQVQKVTLTWGCPKCRHNYQLEDIPDKYYCF
CGKTTNPELQPFLVPHSCGDICGKDLVPLCGHRCLLLCHPGPCPPCPVTVSVTCYCGKKQ
PATRRCSDKKWSCGGPCGKLLTCQKHSCSEVCHPGDCKPCPKKSLQKCLCKTSQKLRDCA
TPIWQCDRVCNKPLQCGNHSCSIVCHEGICDSCPLTKQRTCPCGKSKYQLPCTEETPTCQ
DTCDKLLTCSLHRCNQRCHKDACGACLEIVEKSCKCGLHSKEVHCSKPYFCETKCKRMRD
CNKHPCNKKCCDGSCPPCEKPCGRTLNCGNHKCNSVCHRGLCYPCNQTDVVTCRCGQTKL
TVPCGRKHKTRPPKCSKLCLIPPDCHHEKREPHKCHFGDCPPCKQICNKPRSKCPHLCSA
SCHSAVVVKIESKKASMPWEQTKPQLERKALACPDCEVPVSVTCLGEHETCDWPCYKAVP
SSCHRPCGRQLTCENHTCTLPCHVVDNSPNKISAGQNCEICENPCSKPRPEGCQHDCPKP
CHPGPCPPCKQMLRIRCHCGLNQPYVSCNDWLSPEKREEIQSCGNQCPKNFDCGHRCRAN
CHSGPCPNPELCRRKVKLTCKCKRLKKEFSCETVRNNAAKVECDEICNRKKEEDRKQQEM
INEQKRKEEELKNERELAKYKKIFESKKRTRDRRAHEEEEEVTFIKKYWFLITTFTAVVL
SAVVFFILK
NT seq 2550 nt   +upstreamnt  +downstreamnt
atggctgcacgtaaaaaagaaagcaacgtttggaagaaaaatactaatcataaccggggt
ggtaacactttagtgaattccccgacacctgcagaattgaaatttaaggaagcacatgga
aaacttcaagcggcagtgcagaaatatgtgcaagattatgaatcgtcttcctctgaagac
gagttagaatctgacaatataataggcgaaattattaaaaattacactaaaacaggagcg
aaagatgagtacttagggagaactaaaaccttccttcaggattcgtttttatcagggact
gtcacgtgtctgatttgcatatccagaataaaaagggactcttcaatatggaattgcaat
gaatgctactgtgtcttccacctaacttgtattcaaagatggtccaaggacagtattttt
caacaaaaacaaatacaagaaggtccaattcaagttcagaaagttactttaacgtggggt
tgccccaaatgtagacacaattaccaactggaagatataccagacaagtattactgtttt
tgtggtaaaaccaccaatcctgagcttcagccgttcttggtaccacattcttgtggcgac
atttgtggaaaggatttggtgccactttgtggtcacagatgcttgttattgtgtcatcca
ggtccttgtccaccttgccctgtaacagttagtgtaacgtgttactgtggcaaaaaacaa
ccagctacacgaagatgcagtgacaagaagtggtcctgtggaggcccctgtggcaagctt
ttgacttgtcagaaacacagttgttctgaggtttgtcatcctggtgattgtaagccatgc
ccaaagaaaagtctccagaaatgtttgtgcaaaactagtcagaagttgcgtgactgtgct
acgcccatatggcagtgtgatagggtgtgtaataagccgcttcagtgtggaaatcattct
tgctcaattgtttgccatgaaggcatttgtgattcttgccctttgactaaacaaagaact
tgtccttgtggcaagagcaaatatcagttgccttgtactgaagaaacacctacctgtcaa
gatacttgtgataaattattaacctgcagtcttcatagatgtaatcaacggtgtcacaaa
gacgcttgcggtgcgtgccttgaaattgttgaaaaatcgtgcaaatgtggcctacattca
aaagaagttcattgttctaaaccatatttctgcgaaaccaaatgtaaacgaatgcgggat
tgcaacaaacacccgtgcaataaaaagtgttgtgatggcagttgtcctccatgtgaaaaa
ccctgtggccgtacactcaactgtggcaatcacaaatgcaattcagtttgtcacagaggt
ctctgttacccttgcaaccaaaccgatgttgtgacctgtcgttgtggtcaaaccaaattg
actgtaccttgtggaagaaagcataaaactagaccaccaaagtgtagcaaattgtgttta
attcctcctgactgccaccatgaaaagagggaaccacacaaatgccactttggtgattgt
ccaccctgtaaacaaatctgcaataaaccccgatccaagtgccctcatttatgcagtgct
tcctgtcattctgccgtcgtagtgaaaattgaaagtaagaaggcatcaatgccgtgggaa
caaaccaaaccacaactggaacgcaaggctttggcttgtccagactgtgaagtcccggtt
tcagtcacttgtttaggtgagcatgaaacctgcgactggccttgctacaaagccgttcct
tcaagttgtcatcgtccatgtggacgccaacttacctgtgaaaaccacacttgcaccctt
ccatgccacgtggttgacaactcccctaacaagatcagtgccggccagaattgcgaaata
tgcgaaaatccgtgctccaaaccccggcctgaaggttgccaacacgactgccctaaacca
tgtcaccccggcccttgtccgccgtgcaaacaaatgctccgtatcagatgccactgcgga
cttaaccaaccctacgtgtcttgcaacgattggttgagtcccgaaaaacgcgaagaaatc
caaagttgcggcaatcaatgtccgaagaatttcgattgtgggcacagatgtcgcgcaaat
tgccattcgggcccctgtccaaatccggagctttgtcgcaggaaagtcaaactgacttgt
aaatgtaagaggttgaagaaggagttctcgtgtgagactgttcggaacaatgcggcgaaa
gttgaatgtgatgagatttgtaaccggaagaaagaggaagacaggaagcagcaagaaatg
atcaatgaacagaaacgtaaagaggaggagttgaagaatgagagggaattggcaaagtat
aagaaaatatttgagagtaagaagaggacgagagatcgacgggcgcacgaagaggaggaa
gaagtcacttttattaaaaaatattggtttttgataacgacattcacggcagttgtttta
tctgcagtggtgttttttatacttaagtaa

DBGET integrated database retrieval system