KEGG   Tribolium castaneum (red flour beetle): 659515
Entry
659515            CDS       T01046                                 

Definition
(RefSeq) probable asparagine--tRNA ligase, mitochondrial
  KO
K01893  asparaginyl-tRNA synthetase [EC:6.1.1.22]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:tca00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    659515
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:tca01007]
    659515
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:tca03016]
    659515
Enzymes [BR:tca01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.22  asparagine---tRNA ligase
     659515
Amino acid related enzymes [BR:tca01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   659515
Transfer RNA biogenesis [BR:tca03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    659515
 Prokaryotic type
    659515
SSDB
Motif
Pfam: tRNA-synt_2 tRNA_anti-codon tRNA-synt_2d tRNA-synt_2b
Other DBs
NCBI-GeneID: 659515
NCBI-ProteinID: XP_008192548
UniProt: D2A0S8
Position
LG4
AA seq 470 aa
MFKNHLVFKTVPHLIRRNILNKNFSSISQILDKSGVGDVITVKGWIKSLRDQKEHVFFDV
SDGSTAKKLQILLPKKSKPEDLSTGASVVVSGPLTLSPKGQLELTANSIEVCGKCVVSEG
YPFAPRKQYAAEYIRQYLHFRPRTHKFGALLRLRNAATLAIYNHFNSEGFVNVHTPVLTS
NDCEGAGEVFKVVPDNKKLIKSMAKESQAEDEVYFNQKSFLTVSGQLHLEAVAHGLSKVY
TFGPTFRAENSKSRLHLSEFYMLEGEIAFVEKLDGLMTCIEQLIKQVTKKLVNDSIEDIE
KCQEKKVSFDWLDKSFPVVTYKEAVTILSQNKDKFSENFDSKDGFGKEHEMFLVEYFGKV
PTFVIDWPKDMKPFYMKDNGDGTVAALDLLGPNVGEVVGGSLRENNYEKLLEKIPNSNGH
LDWYLDLRKFGSVPTGGFGLGFERYLQLILGISNIKDTIPFPRWPHNCSL
NT seq 1413 nt   +upstreamnt  +downstreamnt
atgtttaaaaaccatttagtttttaaaactgtgcctcatttaattcgcagaaacattcta
aacaaaaatttctcttcaatctctcagatacttgacaaaagtggtgttggcgatgtcata
acagtgaagggatggataaaatcgttacgggaccagaaagaacatgtgtttttcgacgta
agcgatggttcaactgccaaaaaactccaaattttgcttcctaaaaaatcaaaaccggaa
gatctatcgaccggggcttccgtagtagtttcaggaccccttactctatcaccgaaaggc
cagttggaattaacggcaaacagtatcgaagtctgcggtaaatgcgtcgtaagcgaaggc
tatccttttgcgccacgtaaacagtacgccgctgaatatatcaggcagtatctccacttc
aggccaagaacacacaaatttggggcacttttgcgattacggaatgcggcaacgttggct
atttataatcattttaattcggaaggttttgttaatgtgcatacgccagtcttgacttct
aacgattgtgaaggggctggagaggtgtttaaagtagtccctgacaataaaaagttgatc
aaatcaatggcgaaagagagccaagctgaagatgaggtctactttaatcagaaatcgttt
ttgacggtctcggggcagttgcatttagaagctgtagctcatggtttaagcaaagtttac
actttcgggcccacttttagggccgaaaattccaaatcaagactgcatttgtccgaattt
tatatgttggagggagaaattgcgtttgtggaaaaactagatgggcttatgacctgcata
gaacaattaattaaacaagttacaaaaaaactagtcaatgattcaattgaagacatcgaa
aaatgccaagagaaaaaagtgtcgttcgattggttggataaaagttttcctgtggttacg
tacaaagaagcggtaacaattttaagtcagaataaagataagtttagcgaaaattttgat
tccaaagatggttttggtaaagaacatgagatgttcctggttgaatatttcggaaaagtg
cccacttttgtcatagactggccaaaagacatgaaacccttttatatgaaagacaatggg
gacggaaccgtggccgcacttgacttattggggcctaatgttggcgaggtcgttggcgga
agtctgcgtgaaaataattacgagaaattgctagaaaaaatccccaattccaatgggcac
ttggactggtatttggacttgaggaaatttggatcggtgccaactggcggatttggttta
ggttttgaaagatatttgcaactaattttgggaataagcaatatcaaagacacgattccc
tttcccagatggccgcataattgcagtttgtag

DBGET integrated database retrieval system