KEGG   Tribolium castaneum (red flour beetle): 659717
Entry
659717            CDS       T01046                                 
Symbol
NLG-4
Name
(RefSeq) neuroligin 4
  KO
K07378  neuroligin
Organism
tca  Tribolium castaneum (red flour beetle)
Brite
KEGG Orthology (KO) [BR:tca00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tca04131]
    659717 (NLG-4)
Membrane trafficking [BR:tca04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Others
    659717 (NLG-4)
SSDB
Motif
Pfam: COesterase BD-FAE Abhydrolase_3 MLANA ATG2_CAD
Other DBs
NCBI-GeneID: 659717
NCBI-ProteinID: XP_015835573
BEETLEBASE: TC013956
Position
LG5:2916555..3057147
AA seq 948 aa
MGIKSRGIVWILIFSTLILSSQCNSFMKNAKISPRIVQTRYGRLQGLVVPMHRYLKPIEV
FLGVPYATPPVQSNRFSPTRTPSPWDGVRISDKMGPVCPQKLPDISNETAALEKMPKGRL
EYLKRLLPYLKNQSEDCLYLNIYAPAQVSNEARHPVIVYIHGESFEWNSGNPYDGSVLAA
YAELVVVTLNYRLGILGFLNANPAPHLKARVANYGLMDQIAALHWIQQNIALFGGDPDNV
TLAGHGSGAACINFLMISPTVMPGLFHRAILLSGSALSSWALVEDPVNYAVKLAREVNCT
IPEDVGKDHEAIVDCLRDTPLHDLLQADVTPPAYLSAFGPSVDGVVIKADFAKELVTYFK
PSDLQSFVGPVNANMKRSEATLTPRGSNPYDLLFGVVTSEALWRFSATDIQAGFEGERRD
KIIRTYVRNAYTYHLSEIFFTVVNEYTDWERTVQHPINTRDAAVAALSDAQFVAPLVQTG
DLLSAKPPQPGQEPSGSKTFFYVFDYQTKDGDYPQRMGTVHGEELPYFFGAPLVDGFNHF
PKNYTRSELALAEAVIIYIANFARTGNPNEQHKQEPILAASKERNRFRSIVWDEYDSVHQ
KYLEIGMKPRMKNHFRAHQLSVWLRLIPELHRAGMEDVVARHNLFRNHNNADLYDGAVRP
DPLSRVSYYDPTMELFRRRPNSSLSGLEAPTTMDTIVTTCVNVVSSGNFNHQTYQNQNTS
TDTLASLEAAGYAAYSTALSVTIAIGCSLLILNVLIFAGVYYQRDKTRMEVKSLQQQQSR
NQATFETISKHGHYHMGHSQSANVIVDVEQDTSAMIMAANAQHDKQHLCPSNIQMSNTLK
APPPSPSVMMQNCMTLPKNASSYGQNYNPGSMTLPKNATLLNNTACVIAEMQQQGLVQPP
NGNATMPMSVPRPPPPPRTKSPPESQPLLANNKGNMRVPQAAMSEMRV
NT seq 2847 nt   +upstreamnt  +downstreamnt
atgggcattaagagcaggggaatcgtctggattttaattttctccactttgatactttcg
agccaatgcaactcgtttatgaagaacgccaagataagcccgaggatcgtgcagacgcgg
tatgggcggctgcagggcctggtggtgcccatgcaccgctacctcaaacccatcgaggtc
ttcctgggcgtcccatatgccacgccgccagtccagtccaacagatttagccccacacgg
acgcccagcccctgggacggagtccgcatttcggacaagatgggtccagtgtgcccacag
aagctcccggatatcagcaacgaaaccgcagctttggagaagatgcccaaggggcggctg
gagtatttgaaacggcttctcccttacttgaaaaaccagagcgaagactgcctttatttg
aacatttatgcccctgcacaagtttccaacgaagctcgccatcctgtgatagtctacata
catggcgagtccttcgagtggaactcgggcaatccctacgacgggagcgtcctagcggcg
tatgccgaactcgtcgtagtcacactaaactataggctaggaatcttaggttttttaaac
gcgaaccccgccccccacctcaaagcccgcgtggccaactacggcctcatggaccagatc
gccgctctgcactggatccagcagaacatcgccctcttcggcggagacccagacaacgtg
actctggccggccacggctccggagctgcttgcatcaacttcctcatgatttcacccaca
gtcatgcctggccttttccaccgcgcaatcctcctctccggctccgccctgtcttcgtgg
gccctcgtcgaagacccagttaactacgccgtcaagctggcccgcgaagtcaactgcacc
atccccgaggacgtcggcaaggaccacgaagctatcgtcgactgcctccgggacactccg
ctccacgacctcctccaagccgacgtcactccaccggcgtacctgagtgcgtttgggccc
tccgtcgacggtgtcgtgatcaaagcggacttcgccaaggagctggtgacgtatttcaaa
ccctcggacttgcagagcttcgtagggccagtgaacgccaacatgaagaggagcgaagcg
acgctgactccgagagggagtaacccctacgaccttttgttcggggtggtgaccagcgag
gcgctgtggaggttctcagcgacggatatccaggcggggtttgagggcgaaaggcgggac
aaaatcataaggacttatgtgagaaacgcgtatacgtatcatttaagtgagattttcttt
acggtagtgaatgagtacacggattgggagaggacggtccaacatccgattaacacaaga
gacgcggcagtggcggcgctgagtgatgcacagtttgtggcgccactggtgcaaaccggg
gatttgttaagtgccaaaccgccgcaacccggacaagaaccctcagggtccaagactttc
ttctacgtgtttgactaccaaaccaaagatggggactatccccagcgcatggggacagtc
cacggcgaggagctcccctacttctttggggcgcctttggtggacggcttcaaccacttc
ccgaagaactacacccggtccgaactggctctggccgaggccgtcatcatctacatcgcc
aatttcgcacggacgggtaaccccaacgagcagcacaagcaggaacccatcctggccgcc
tccaaggaacgcaaccgcttcaggtccatcgtctgggacgaatacgactcagtccatcaa
aagtacctcgagataggcatgaagccccggatgaagaaccatttccgggcccatcaatta
agtgtgtggctgcgtctgatcccggagctgcaccgcgccggaatggaggacgtcgtggcc
agacacaatctcttcaggaatcacaataacgcagacttgtacgacggggccgtccgccct
gaccccttatctcgagtcagttattacgaccccacgatggagctattccgccgccgaccc
aactccagtctttccgggctagaagcccccacaacgatggacacgatcgtaacgacttgt
gtcaacgtcgtttcatcgggaaatttcaaccaccaaacctaccagaaccaaaacacctcg
actgacaccctggccagtttggaggcggcgggatacgccgcctacagcacggctttgagt
gtcaccatcgcgattgggtgctcgttgctgattttaaatgtactgattttcgccggagtg
tactaccagagggacaagacgcgcatggaggtcaagtcgctccagcagcaacaaagtcgg
aatcaagccacgtttgagaccatctccaagcatgggcactaccatatgggacattcgcag
agcgcgaatgtcatcgtggacgtggaacaggacacctcggcgatgatcatggcggcgaat
gcccaacacgataaacagcatctgtgccccagcaacatacaaatgtccaacacgttgaag
gcgccgccccccagcccgagcgtgatgatgcagaactgcatgaccctgccgaagaacgcc
tccagctacggccagaactacaaccctgggagtatgaccctccccaagaacgccacattg
ctgaacaacacggcgtgcgtgatcgccgagatgcagcagcagggcttggtgcagcccccc
aatggcaacgcgacgatgccgatgagcgtgcctcggccgccgccgccccctcggaccaaa
agtccgccggaaagccagcctttgttggccaacaacaaagggaacatgcgagttccacaa
gcggccatgagtgagatgcgcgtgtga

DBGET integrated database retrieval system