KEGG   Tribolium castaneum (red flour beetle): 659958
Entry
659958            CDS       T01046                                 
Name
(RefSeq) nipped-B-like protein
  KO
K06672  cohesin loading factor subunit SCC2
Organism
tca  Tribolium castaneum (red flour beetle)
Brite
KEGG Orthology (KO) [BR:tca00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:tca03036]
    659958
Chromosome and associated proteins [BR:tca03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   Adherin complex
    659958
SSDB
Motif
Pfam: Nipped-B_C Cohesin_HEAT GRIP
Other DBs
NCBI-GeneID: 659958
NCBI-ProteinID: XP_008200559
UniProt: D6W7B2
Position
LGX:complement(4473990..4486316)
AA seq 1962 aa
MDREIPSVPITTLAGVASLTDLLPEMPLPTPSPQTLSNKSLLFHPRVAEEAQNLLGVRDE
VLVPQLVHSLVQTSAEHIEVKDNYASTETKVDQQESMPELLRAMLDRNPNVFSGSATATL
SSAQQWNHTGQPTIPVKESPSTYNQQSPQGSPISPATRQPRPSVITEQKTTPLVNCNSTH
ISNNAVLNDQDETHKETGTAEQLRQLRKPPKGFSPSQTNDTSQKAQEPESSDSQKPPGEL
SDARPESMAVSETNSEPENSHQTVIKQPIVKLDRLSVEDQLLMQKSLSKFVETRPKMAKE
LGIVLSREEKEESDSESDGIDGDKPKRKKEKKRNHNESDDEFVPDTFSALVGSNKKRKVA
QKEDKPEPIVVKPKLRRVEKKFVPVLEKLSQEELMETNTYLRFNKSIEHVLKSAEDIDMN
EIAEDGIIQEEYLMSRVVMQELCTEAAKLKILGAMEMIPTDKLVRLLNVLEINVRGGDRV
SPILDEDNESLRQLWLESTMERVMGAADACLICLYIMTSPNMPKRVYLEEVIDRVVLYIK
YHLRNTIFPSFDSTYRLDNKKKDGRKKKATPVSEKSILVLYTKISELVNLLAELLNIQIL
TDTSVLHASSMGVSPFFVENVSELQLACLKLVTTIFTRYETHRRLLLDDILASIARLPST
KRSLRTYRLNSEEHIQMLTALVLQLIQCVVALPDNLANKNFQDSTQSANVKVVDKDILIS
SKYDKAASTATTFLSVFLNKCGSKSEDIDYRPLFENFVQDLLSTVNKPEWPATEVLLSFL
GRMLVRTFSNKSNDMSLRVASLEYLGVVAARLRRDSVLSRCKLDTIDQMIKDIKSEEMKD
NDEQTKKKNMSANTEEERTQFLQRVLLDFLAVNAQNDEAYKYARHFYIAQWYKDAVSEKS
QLASGAKDSKKYSRDNHRAKRHNRDSDEGSDSEEEKQDQEQDNADKFKAIEEKKKLLIQR
IRPFQETISSGNRVQIFQTYIDYNSAELIAQYLASKRYFSQSFDMYLKAILMVLKETSIA
IRTKAMKCLTMIVEADPSVLGRHDMQMGVNHSFLDHSTSVREAAVDLVGKFVLSRPELID
KYYEMLSARILDTGVSVRKRVIKILKDICIECPEFPKIPEICVKMIRRVNDEEGIRKLVM
EVFQNMWFTPTKDTSLLRKVMNITDVVASSKEIGLEWFEQLLLSLFKPKEDKDDSTKVQT
EPPKALLLACRQIVDCLIENVLRLEETNDSTGSSQRLVACLTTLYLFAKIRPQLLVKHAS
TLQPYLGLKCQSSGDIQIISSVAKMLELVVPLMDHPSESFLAQLEEDAMKLVLQHQRSIV
SSCLSCLGAIVNKVTRNYQLIRDCFKRYNAYMIRFKGWLETENVKYLRDPKFRQYFRRAL
FTVGLLLRYFDFKDPDVIGDLPLDIKDQVYQSMIYFLHREDLDIQANTLKAIGSICIRHY
EFMLEKELKIFYHKFLTSEDTQLKMRVEVLINIESYLVEEENRMIQQDLEWSKRSKEENL
KEMGDVSSGMASTVIQLYLKEILQSYLHSDLSVRQAALRVIQLVLQQGLVHPVQIVPYLI
CMSTDSEKLVSHSADKQLLEIEKKYPGFIHTKSSLGIALSYQLQKILQGNVIVRGSRVRE
PGEYPSSLNGYLYSILRNSRQQRRALILNILKQFDEQVRTSLSYMLYLADNLAYFPYMVQ
DEPLFIVHHIDIMISVSGTNLLQSFREGLIMTEAQRMALESGNDNSVQNVVSALDEDDDD
EDALVSRVPEDTRQLQAYLTTAQGCLLLLMLKQHLKDIYGLSDSKIQQYSPSEAAKVYEK
NASRRINTLFNPKCTIQKLKEGNPPEYLDEEGRRDLIRQYLDFKQLMLKLDPDDPDDEEN
SKVLTALGSGNVSGAHPSGAATSILTEADQVALENYKDTSPPKVPKLVISSRRLDSDTKR
TPRSQRPSEKLKKHRHKKKRRKFVSSSGDESENDYSDPDFLA
NT seq 5889 nt   +upstreamnt  +downstreamnt
atggatcgggaaattccgagtgttcccatcaccactttggcgggggtggcaagtctaaca
gacttgctgcctgaaatgccactacccaccccatcccctcaaactctgagcaacaaatct
ctgctatttcacccgagagtagcggaagaggcacaaaatttgcttggagtccgggacgaa
gttctagttccccagttagtacactcgttagtacaaacttcagcggaacatatagaagtt
aaagataactatgccagtactgagacaaaggttgaccaacaggaaagcatgcctgaacta
cttcgcgcgatgctcgatcgtaacccgaacgtatttagcggctccgcaacagcaactttg
tcgtctgcacaacaatggaaccacacaggtcaaccgacgataccagtgaaggaatcacct
tcaacttacaaccagcagtcacctcagggaagtccgatttcaccagctacgagacaaccc
aggccttccgtcattaccgaacaaaaaacaactcctctcgttaactgcaacagcactcac
atatctaataatgcagttctcaacgatcaggacgaaacccacaaggaaaccggaactgct
gaacaacttagacaattgagaaaaccacccaaaggtttttcgccgagtcagacgaacgac
acgtcccaaaaggcgcaagagcctgagagttcggactctcaaaaacccccgggcgaacta
agcgatgctagacccgaatctatggctgtgtctgaaacaaattcggaacctgagaattct
catcaaaccgtaataaaacaaccaattgtaaaactagaccgactatccgtcgaagatcag
ttactaatgcagaaaagtctttcgaaatttgtcgaaacgcgaccgaaaatggcgaaagag
ttaggtattgtactttcaagagaggagaaggaagagtctgattcagaatcggacggtata
gacggcgataaacccaagcggaagaaagagaagaaacgaaatcacaacgaaagcgatgac
gagttcgtaccggacacgttctcagccttagtcggaagcaataaaaagaggaaagtcgca
cagaaagaagacaaaccggaaccgattgttgttaaaccgaaattgagacgagtagagaaa
aagttcgtcccggttttggagaaattgtcgcaagaggagcttatggagactaacacgtat
ttaaggtttaacaagtctattgaacacgttcttaaatcggccgaagacattgatatgaac
gaaattgccgaagatgggattattcaagaggaatatcttatgagtcgagttgtaatgcaa
gaactgtgtaccgaagccgccaaattgaaaatactaggcgctatggaaatgatacctact
gataaattggtcaggttgttgaacgttttggaaataaatgtacgaggaggagatagggta
tccccaatacttgacgaggataacgaaagtcttcgtcagttgtggctcgagagcaccatg
gagcgcgtaatgggggccgcagacgcgtgtctaatatgcctctacataatgacgtcaccc
aatatgcctaaacgagtctatttagaagaagtgattgatcgtgtagtactctatatcaaa
tatcatttgcgcaatacgatttttccatccttcgattcaacgtatagattagataacaaa
aagaaagacggacggaaaaagaaagcaacaccagtttcggaaaagagtatactagttttg
tatacgaaaatttctgaactagttaatttattagccgaattgttgaacatccaaatttta
actgatacatccgtgctacacgcatcatcaatgggggtttcgccattttttgtggaaaac
gtcagcgaactccagttggcctgtctcaaacttgtaacaacgattttcacgcgttatgaa
acacatcgaagactattgttagacgatatcttggcttctatcgctcgtcttcctagtaca
aaacgtagcttacgaacctataggctaaatagcgaggagcacatccaaatgttaacagct
ttggttctacaattaatacagtgtgttgtcgcattgcctgataatctagcgaataaaaat
tttcaagatagcacacagagcgcaaacgtgaaagttgtggataaggacattttaattagt
agtaaatatgacaaggcggcatctaccgcaacaacatttcttagtgtgttcttgaacaaa
tgcggtagtaagtctgaagatatcgactataggccgttgtttgagaattttgtgcaagat
ttattatcaaccgtgaataagcctgaatggccggcaaccgaagtgcttttgagtttttta
ggccgaatgcttgtccgcactttctcaaataaatcgaatgatatgtcactcagagtcgcg
agtttagagtatttaggtgtagttgcggcacgattacgacgcgatagtgttctgtcgcga
tgtaaactagacaccatcgatcaaatgataaaagatatcaaatctgaagaaatgaaagac
aatgatgaacaaacaaagaaaaagaacatgtcggcaaacaccgaggaagaaaggacgcaa
tttttgcagcgtgtccttttagacttcctggccgtcaatgcccaaaatgacgaagcttat
aaatacgcacgacatttctacatcgctcagtggtacaaagacgcagtttctgaaaagtct
caattggcatcaggcgctaaagacagcaaaaaatactcgagagacaatcatcgagcgaag
cggcacaacagagatagtgacgaaggttccgacagtgaagaggaaaagcaagatcaagaa
caagacaatgccgataaattcaaagcaattgaagaaaagaagaaactactaatacaaaga
attcggccgtttcaagaaacgatatcatcaggcaaccgcgttcagatttttcaaacgtac
atcgactacaacagtgccgaactaatcgcgcaatatctggcttcaaaacgttacttttcg
cagagcttcgacatgtacctgaaagcgatacttatggttttgaaggaaacttcaatcgcg
ataagaaccaaagctatgaaatgtctaacaatgatcgtcgaggccgatccctcggtttta
ggccgtcacgacatgcaaatgggcgtaaatcattcctttctcgaccattcgacttcggta
cgcgaagcagccgtcgacctagtcggaaaatttgtcttgagccgtcccgaactgattgat
aaatactacgaaatgctttcggcgcgtattttagacaccggtgtcagtgtccgaaaacga
gtcataaaaatccttaaagacatttgcatcgaatgtcccgaatttcccaaaataccggaa
atttgcgttaaaatgattcggagagtgaacgacgaggaagggatcaggaaattagtaatg
gaagtgtttcaaaatatgtggtttacgccaactaaggacacgtctttgttgcgcaaagtt
atgaacatcacggatgtcgtagcctcgtccaaggaaattggcctggagtggtttgagcaa
cttctgctcagtttatttaagccgaaagaagacaaagatgactcgaccaaagtgcagacg
gagcctccgaaagcactgttactggcgtgtcgtcagatcgtcgattgtctgattgagaat
gtgctcagattggaggaaacaaatgatagtacagggtcgtctcagcgcttagttgcttgt
ctcaccactctttacttattcgcgaaaataagaccgcaattgctcgtcaagcatgcaagt
actctccaaccgtatctcggattgaaatgccaatcaagcggggacatacagataattagt
agtgtagcaaaaatgctagagcttgttgtgcctctgatggaccatcccagtgaatcgttt
ttggctcagttggaagaagacgcaatgaaattagtgttgcaacatcaaagatctattgtt
agtagttgtctgtcttgtctcggagcgattgtcaacaaagtcacgcgaaattatcaactg
attagggactgtttcaaacgatacaatgcttatatgataagattcaaaggttggttggag
acagagaatgttaagtatctcagggaccctaagtttaggcagtacttcaggcgggcactt
ttcacagttgggttattattgcggtactttgatttcaaggatcctgacgtcattggtgat
ctaccgttggatatcaaagatcaagtctaccagtcaatgatatactttttgcatcgcgag
gatcttgatatccaagccaacacactgaaggcaattggttctatttgtatccgacattac
gagtttatgttagagaaagaactgaaaattttctaccacaaatttctaacatctgaagat
acgcagttaaaaatgcgtgtcgaggttcttatcaacattgaaagttacttggtcgaggaa
gaaaacaggatgatacagcaggatcttgaatggtcaaaacggtcgaaggaagagaatttg
aaagaaatgggtgatgttagttccggtatggcaagtacagttatccaactatatttgaaa
gaaatcttgcaatcgtatctacacagcgatttatcagttaggcaagccgcgttgagagtt
attcagttggtgttgcaacaaggtttggtccatcctgttcagatcgtcccctatttgatt
tgtatgagtaccgactcggaaaaattagtatcccacagtgccgataaacaactgctcgaa
attgagaagaagtatcctggttttattcacacgaaatcttcgctcgggatcgcgttatct
taccaactacagaagatcttgcaaggcaatgtgattgtgcgaggatcacgtgttcgcgaa
cctggcgaatatccttcgtccttaaacggttacttgtactcgatattacgcaattctaga
caacaaagacgtgccttaatcttaaatattttgaaacaatttgatgaacaagtgcggacg
agtctatcgtatatgttgtacttggctgacaatttggcgtattttccgtacatggtgcaa
gacgagccgcttttcatcgttcaccacattgacattatgatctcagtatctggaacgaat
ctactccaatcgtttagagagggtttgatcatgaccgaagctcaacgaatggccttggag
tcggggaatgacaacagcgttcaaaacgtagtgtcagccctcgacgaagacgacgacgat
gaggatgcgttagttagtagagtaccggaagatacgagacaattacaagcttatcttact
acagcacagggttgtttgcttttgctcatgttgaagcaacatttgaaggatatttatggc
cttagcgatagtaaaatacaacaatattctccatcggaagccgcaaaggtgtacgagaaa
aatgcttcgcgacgtatcaacactctatttaatcccaaatgtacaatacaaaagttgaaa
gagggtaatccgcccgagtatttggatgaggagggcaggagagacctcattcggcaatat
ctagatttcaagcagttgatgctgaagctggatccggacgatccggacgacgaggagaat
tcaaaggtgttgacggcgttgggttcgggtaacgtttccggggcgcacccgtcaggagcc
gctacgtcaattctgaccgaggccgatcaagtagctttggaaaattataaggatacttca
ccgccaaaagtgcccaaattggtgatttcgagtcggaggttggatagtgatacgaaacgt
acgcctcgttctcaaagaccatccgaaaaacttaaaaaacatagacacaaaaagaagcga
cggaagtttgttagttcatcgggtgacgaaagtgaaaatgactacagtgacccggatttt
ttggcctag

DBGET integrated database retrieval system