KEGG   Tribolium castaneum (red flour beetle): 659969Help
Entry
659969            CDS       T01046                                 

Gene name
babo, baboon
Definition
(RefSeq) TGF-beta receptor type-1
  KO
K04674  TGF-beta receptor type-1 [EC:2.7.11.30]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca04068  FoxO signaling pathway
tca04144  Endocytosis
tca04350  TGF-beta signaling pathway
tca04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:tca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    659969 (babo)
   04068 FoxO signaling pathway
    659969 (babo)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    659969 (babo)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    659969 (babo)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tca01001]
    659969 (babo)
Enzymes [BR:tca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     659969 (babo)
Protein kinases [BR:tca01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   659969 (babo)
Cytokine receptors [BR:tca04050]
 TGF-beta receptors
  Type I TGF-beta receptor
   659969 (babo)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr TGF_beta_GS Activin_recp Pkinase_fungal Insulin_TMD FTA2 APH DUF4617
Motif
Other DBs
NCBI-GeneID: 659969
NCBI-ProteinID: XP_008190529
Position
LG3
AA seq 532 aa AA seqDB search
MPPKTHRNNMARTSLLVFCCAVFWLSRLDNGVQALKCKCDNCKETNYTCQTDGYCFTSTY
LSKSGGVEHNYRCYHKKSIPDIVETSGMSTEFCYRYAVVTNHPDFTKVASSCCDDRDFCN
ANITLSLPNELEWFENASMAAPKFSNFTTAEIVLMSVIPTMLLCFIGVGVYYFYKTKHKR
GGLHHHLRHGEDSIEAPDHPILKGVSLQHMIEMTTSGSGSGLPLLVQRSIARQIQLVEII
GQGRFGEVWRGRWRGENVAVKIFSSREERSWFREAEIYQTVMLRHDNILGFIAADNKDNG
TWTQLWLITDYHEYGSLFDFLGRNTLDTTGMIRMALSIATGLAHLHMDIMGTQGKPAIAH
RDLKSKNILVKSNFTCAIGDLGLAVRHDATTDTVDIPLNNRVGTKRYMAPEVLDETMNVN
HFDSFKRADVYALGLIFWEIARRCNVGGIYDEYQLPFYDAVPSDPTIEEMRRVVCVDKQR
PNIPNRWQSCEALRVMLKLMKECWYHNATARLTALRIKKTLSNFRTSEELKM
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgcctcctaaaacacatcgcaacaacatggccagaactagcctccttgtgttttgttgt
gctgtcttttggctgagccgattggataacggggttcaagcacttaaatgtaagtgcgat
aattgtaaggaaaccaactacacgtgccagaccgatgggtactgctttacatcgacttac
ttgtccaaatctggaggcgtcgaacataattatcgatgttaccacaaaaaaagcatacct
gatatagtagaaacatcaggcatgtcaactgaattttgttaccgatatgctgttgttaca
aatcatccggactttaccaaagtggcatcatcgtgctgtgacgatagagatttttgtaat
gctaatataactttgtccttaccaaacgaattagaatggtttgaaaatgcatcgatggca
gcgccgaaattctccaattttacaacagcggaaatcgtcttgatgtcagtcatcccaaca
atgttgttgtgtttcatcggagttggtgtttattacttttacaaaacaaaacataagcgt
ggagggttacaccaccatttacgtcacggtgaagacagtattgaagctccagatcatcct
attttaaagggtgtgagtttgcaacatatgattgagatgacaacgagtggtagtggctca
ggcttgcctttattggtgcaacgtagcattgctcgccaaatccaattggttgaaataatc
gggcaggggaggtttggcgaggtgtggagagggcgttggaggggtgaaaatgtcgctgtg
aaaattttcagttcacgagaggaacgttcatggtttcgtgaagctgagatttatcaaacc
gttatgttacgacatgataacatcctcggttttattgcggccgataataaagataatggg
acatggacccaattgtggttgattaccgattatcacgaatatggttcgctttttgatttc
ctgggtcgcaatactttggataccaccggtatgatacgaatggctttatctatagccaca
ggtcttgcccatctccatatggatatcatgggtacgcagggcaagccagcaattgcccat
cgtgacttgaagtcaaagaatattttggtcaagtcgaattttacgtgtgctattggtgat
ttgggattagctgttagacatgatgcgacaactgataccgttgatattccgctcaataat
cgagtgggtacgaaacggtatatggcaccggaagttttggacgaaacgatgaatgtaaat
cattttgattcgttcaaacgagccgatgtttatgcgttagggttgattttttgggagatt
gcgaggcgatgtaatgtgggagggatttacgatgagtatcagttaccgttttatgatgct
gtgccgtctgatcccaccattgaagaaatgagaagggtggtgtgtgtcgataaacaaagg
cctaacataccaaaccgttggcagagttgcgaagctctccgcgtcatgttgaaactaatg
aaagagtgttggtatcacaacgcgacagctcgtttaacagctctaaggattaaaaagaca
ctctctaacttccgaacatcggaggaacttaaaatgtga

DBGET integrated database retrieval system