KEGG   Tribolium castaneum (red flour beetle): 660085
Entry
660085            CDS       T01046                                 

Name
(RefSeq) tyrosine-protein phosphatase corkscrew
  KO
K07293  tyrosine-protein phosphatase non-receptor type 11 [EC:3.1.3.48]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca04013  MAPK signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:tca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    660085
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:tca01009]
    660085
Enzymes [BR:tca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     660085
Protein phosphatases and associated proteins [BR:tca01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Non-receptor PTPs
    660085
SSDB
Motif
Pfam: Y_phosphatase SH2 DSPc Y_phosphatase3 PTPlike_phytase
Other DBs
NCBI-GeneID: 660085
NCBI-ProteinID: XP_008200223
UniProt: D7ELF2
Position
Un
AA seq 644 aa
MSSRRWFWPTISGIEAERVLMERGVDCSFLARPSSNNPGSFTLSVKRNGEVTHIKIQNSG
DFYDLYGGEKFATLSELVQYYMENQGQLREKNGEIIELKYPLSCADPTTERWFHGHLSGK
EAEKLILERGKNGSFLVRESQSKPGDFVLSVRTDDKMTHVMIRYSDNQYDVGGGEKFDSL
AELIEYYKKNPMVETSGTVVHLKQPFNATRISASGIHSRVKQLQNENGPNGMGKAGFWEE
FESLQQQEFKHLYSRKEGVKPENRNKNRYKNILPFDDTRVKLKDADPNVPGSDYINANYI
KWKADYCGGNELGSDPSGKVYIATQGCLPSTIADFWQMVWQENCRVIVMTTKETERGKTK
CARYWPDQGTKEYRKIKVKILMESSTPHYTLREFLVSMDGTNCERKVYQYHFQAWPDHGV
PSDPGCVLNFLHEVNKRQESLQQELPDNPPGAILVHCSAGIGRTGTFIVIDMILDQLKKY
GLDCEIDIQRTIQMVRSQRSGMVQTEAQYKFVYLAVQHHIETTTERMKAEQKSMQIGREY
TNIRYSSDIGSTLSSSATSGLGSTTSLSSRSSTLAHFPTPSPNSVILRGETKKPPRAVSD
IPLPRPPDDLVKPTLYENIPVSERKHSGTSSSLNCPVPPPRKAT
NT seq 1935 nt   +upstreamnt  +downstreamnt
atgagttcccgaagatggttttggcccacaatcagtgggatagaggctgaaagagtttta
atggaaagaggagttgattgcagtttcttggcaagacctagttcaaataatcccggatcg
ttcacgttatcagtcaagagaaatggagaggttacccacattaaaatccaaaattctgga
gacttttatgacctgtatggcggcgagaaatttgcaactctctcagagttggtgcagtat
tatatggaaaatcaggggcaacttagggagaaaaatggggaaattatcgaacttaagtat
cccctgagctgtgccgaccccacaactgagagatggtttcatgggcatttgtccgggaaa
gaagcagaaaaattaattctagaacgaggtaaaaatggtagctttttagtgcgagaaagt
caatcgaagcctggcgattttgttctttctgttcgaaccgacgacaaaatgactcacgtc
atgattagatattccgataatcaatacgatgttggtggcggcgagaaatttgatagtttg
gctgaactcatcgagtattacaaaaagaatccgatggtcgaaacttcaggaacagtcgtt
cacctgaaacagcctttcaatgcaactagaatcagtgcttcggggattcactcccgagtc
aaacaattgcaaaacgagaatggtcccaatggcatgggcaaagccggcttttgggaggaa
ttcgaatcgttgcaacagcaagaattcaaacatttgtattcacggaaagagggtgttaaa
ccagagaatagaaacaagaatcggtacaagaatattttgccttttgacgatacacgagtc
aagttgaaagatgcggatcctaatgttcccggatcggattacattaacgcgaattacatt
aaatggaaagctgattattgcggagggaacgaattaggaagtgatccaagcggaaaagtg
tacattgcaacccaaggctgtttaccttccacgatcgccgatttttggcaaatggtatgg
caggagaattgtagagttatagtaatgacaaccaaagagactgaacgaggcaaaacgaag
tgtgccaggtattggccggatcagggaacaaaagagtaccgaaaaattaaagtgaagata
ttgatggagtcgtccactccacattacactcttagagagtttctagttagcatggatgga
acaaattgtgagagaaaagtttaccagtaccattttcaggcatggccggatcatggcgtg
ccttcagacccaggctgtgttttaaattttttgcatgaggttaataagagacaggaaagc
cttcagcaagagcttccagataatcccccaggtgctattttagtgcattgttctgctggt
attggaagaactggcacttttattgttattgatatgatcttggaccagcttaagaaatac
ggtttagactgtgagatagatatacaacgcacaattcagatggttaggtcccaacgttct
ggaatggttcaaactgaagcccaatataaatttgtttatttagcagtacaacaccatata
gagacaactactgaaagaatgaaggctgaacaaaaatcaatgcaaataggccgggagtac
acaaacataagatatagcagcgatataggcagcacgttatcgtcatcggcgacgagtggt
ttaggaagtacaacttcgctgtctagtcggtcttccacattggcccactttccgacccca
tctcccaattctgtgattttaagaggcgaaacaaagaagccacctcgagctgtgtcagat
attccattgcccaggccgcctgatgatttggtgaagcctactctgtatgagaacattcct
gtcagcgaacggaaacattcagggacttcgagctctttgaattgtcctgtgccgcctccg
cggaaggcgacgtga

DBGET integrated database retrieval system