KEGG   Tribolium castaneum (red flour beetle): 660163
Entry
660163            CDS       T01046                                 
Name
(RefSeq) alpha-L-fucosidase-like
  KO
K01206  alpha-L-fucosidase [EC:3.2.1.51]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca00511  Other glycan degradation
tca04142  Lysosome
Brite
KEGG Orthology (KO) [BR:tca00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    660163
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    660163
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tca04147]
    660163
Enzymes [BR:tca01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.51  alpha-L-fucosidase
     660163
Exosome [BR:tca04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   660163
SSDB
Motif
Pfam: Alpha_L_fucos Fucosidase_C GHL6 Phage_Treg
Other DBs
NCBI-GeneID: 660163
NCBI-ProteinID: XP_008190884
Position
LG3:complement(5219771..5221593)
AA seq 466 aa
MFRQTKMKQNLYCCLLLAITGNTIANTPQTVQVPGDTHYEPTWDSLDTRPIPSWFDEAKI
GIFLHWGVFSVPSFGGEWFWAYWKGEEPEFVDFIEKNYPPGWSYQEFAKDFTAEFFDPDE
WAQLFKKSGAKYVVLTSKHHEGYALWPSKYSFGWNAQDIGPHRDLIGDLAKGVRSKGLRF
GLYHSLYEWFNPLYLSDKNNSFQSQEFVNNKMLPEMYELINNYEPSILWSDGDWEANDTY
FRSTEFLAWLYNESPVKNEILVNDRWGIGIPCKHGDFYSCKDRYNPGVLQSHKWENAMTL
DKESWGYRRNANITSYLTTHDLIQTLAETISCGGNLLINVGPTKEGTIIPIFQQRLTDLG
NWLSINGEAIYSSKPWKAQNDTLTPGVWYTTNSLNTVYAIVLQWPEKNVLELESVFGLFS
ESNANVTMLGYKSELKWNIDAKSVSIQFPNKATVTSQWAWVLKITK
NT seq 1401 nt   +upstreamnt  +downstreamnt
atgtttcgacaaaccaagatgaaacaaaacctctactgttgtttactgcttgctattacc
ggtaatacgatcgccaacactccccaaactgtccaagtacctggagacacccactacgaa
cccacatgggacagtctggacactcgccccatcccatcatggttcgatgaggccaaaatc
ggaattttcctccactggggagtgttctcagttcccagttttgggggcgagtggttttgg
gcttattggaaaggtgaagaaccagaatttgtagacttcattgagaaaaattatcccccg
ggttggtcgtaccaggaatttgccaaggatttcacagcggagtttttcgacccagatgag
tgggcccaactgttcaaaaaatcaggagccaaatacgtggttctcacaagcaaacaccac
gaaggctacgccctttggccctcgaaatactccttcgggtggaatgcccaagacatcggg
cctcatcgagatttaatcggtgatttggcaaaaggagtgcggagcaaaggcctgagattt
ggtctgtaccactcgctgtacgagtggttcaaccctttgtacctttcggataagaacaac
tcgttccagagccaagaattcgtcaataataaaatgctgccggagatgtacgaactcatc
aacaattacgagccttcaatattatggtctgacggtgactgggaggcaaacgatacttat
ttcagatcgactgagtttttagcctggctttataacgaaagtccggtaaaaaatgaaatt
ctcgttaatgatagatgggggattgggattccgtgcaaacacggcgatttttattcgtgc
aaagacaggtataaccccggggttttgcagtcgcacaaatgggaaaatgcaatgacgctt
gacaaagaatcatgggggtacagacgcaacgccaatataacgtcatatctcacaacccac
gatttaatccaaactttggccgaaacaattagctgcggaggaaaccttctcattaatgta
gggccaactaaagaaggcaccattataccaatatttcagcaacgattaacagatttagga
aattggctttcgataaatggtgaagctatttacagtagtaaaccgtggaaggcgcaaaat
gatactctgacacctggagtttggtacacgaccaatagtttgaatacggtgtatgctatt
gttttacaatggcctgaaaaaaatgttcttgagttggaatcagtatttgggcttttttcc
gaatctaatgcaaacgtaacaatgttgggttacaaatcggaattgaagtggaatatcgat
gcaaaaagcgtgagcatccagtttccaaataaagccacggtgacgagtcagtgggcctgg
gtcttgaaaatcaccaagtga

DBGET integrated database retrieval system